Recombinant Full Length Human CSF2 Protein, GST-tagged

• Cat.No.: CSF2-2157HF
• Product Overview: Human CSF2 full-length ORF ( AAI14000.1, 1 a.a. - 144 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 144 amino acids
• Description: The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of granulocytes and macrophages. The active form of the protein is found extracellularly as a homodimer. This gene has been localized to a cluster of related genes at chromosome region 5q31, which is known to be associated with interstitial deletions in the 5q- syndrome and acute myelogenous leukemia. Other genes in the cluster include those encoding interleukins 4, 5, and 13. [provided by RefSeq, Jul 2008]
• Molecular Mass: 42.7 kDa
• AA Sequence: MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CSF2 colony stimulating factor 2 (granulocyte-macrophage) [ Homo sapiens ]
• Official Symbol: CSF2
• Synonyms: CSF2; colony stimulating factor 2 (granulocyte-macrophage); granulocyte-macrophage colony-stimulating factor; GM CSF; GMCSF; granulocyte macrophage colony stimulating factor; molgramostin; sargramostim; CSF; colony-stimulating factor; granulocyte-macrophage colony stimulating factor; MGC131935; MGC138897
• Gene ID: 1437
• mRNA Refseq: NM_000758
• Protein Refseq: NP_000749
• MIM: 138960
• UniProt ID: P04141