Active Recombinant Mouse Csf2 Protein

• Cat.No.: Csf2-045M
• Product Overview: Purified recombinant protein of Mouse colony stimulating factor 2 (granulocyte-macrophage) (Csf2) without tag was expressed in E.coli.

Specification

• Species: Mouse
• Source: E.coli
• Description: Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes.
• Bio-activity: The ED50 as determined by the dose-dependent stimulation of the proliferation of murine FDC-P1 cells is less than or equal to 0.05 ng/ml, corresponding to a specific activity of > 2 x 10^7 units/mg.
• Molecular Mass: 14.2 kDa
• AA Sequence: MAPTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPVQK
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Purity: >95%, as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.
• Storage: Store at -80 centigrade.
• Storage Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Reconstitution: Resuspend the protein in the desired concentration in proper buffer.

Gene Information

• Gene Name: Csf2 colony stimulating factor 2 (granulocyte-macrophage) [ Mus musculus (house mouse) ]
• Official Symbol: Csf2
• Synonyms: Csf2; colony stimulating factor 2 (granulocyte-macrophage); CSF; Csfgm; GMCSF; Gm-CSf; MGI-IGM; granulocyte-macrophage colony-stimulating factor; colony-stimulating factor; granulocyte-macrophage colony stimulating factor 2; put. GM-CSF
• Gene ID: 12981
• mRNA Refseq: NM_009969
• Protein Refseq: NP_034099
• UniProt ID: P01587