Recombinant Full Length Human CRMP1 Protein (1-572 aa)
Cat.No. : | CRMP1-1662H |
Product Overview : | Recombinant Human CRMP1 Protein (1-572 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Neuroscience. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 1-572 a.a. |
Description : | Necessary for signaling by class 3 saphorins and subsequent rodeling of the cytoskeleton. Plays a role in axon guidance, invasive growth and cell migration. May participate in cytokinesis. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 64.2 kDa |
AA Sequence : | MSYQGKKSIPHITSDRLLIKGGRIINDDQSLYADVYLEDGLIKQIGENLIVPGGVKTIEANGRMVIPGGIDVNTYLQKPSQGMTAADDFFQGTRAALVGGTTMIIDHVVPEPGSSLLTSFEKWHEAADTKSCCDYSLHVDITSWYDGVREELEVLVQDKGVNSFQVYMAYKDVYQMSDSQLYEAFTFLKGLGAVILVHAENGDLIAQEQKRILEMGITGPEGHALSRPEELEAEAVFRAITIAGRINCPVYITKVMSKSAADIIALARKKGPLVFGEPIAASLGTDGTHYWSKNWAKAAAFVTSPPLSPDPTTPDYLTSLLACGDLQVTGSGHCPYSTAQKAVGKDNFTLIPEGVNGIEERMTVVWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDADVVIWDPDKLKTITAKSHKSAVEYNIFEGMECHGSPLVVISQGKIVFEDGNINVNKGMGRFIPRKAFPEHLYQRVKIRNKVFGLQGVSRGMYDGPVYEVPATPKYATPAPSAKSSPSKHQPPPIRNLHQSNFSLSGAQIDDNNPRRTGHRIVAPPGGRSNITSLG |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | CRMP1 collapsin response mediator protein 1 [ Homo sapiens ] |
Official Symbol | CRMP1 |
Synonyms | CRMP1; DPYSL1; DRP 1; DRP1; DRP-1; CRMP-1; ULIP-3; |
Gene ID | 1400 |
mRNA Refseq | NM_001014809 |
Protein Refseq | NP_001014809 |
MIM | 602462 |
UniProt ID | Q14194 |
◆ Recombinant Proteins | ||
CRMP1-12HFL | Recombinant Human collapsin response mediator protein 1 protein, His tagged | +Inquiry |
Crmp1-2316M | Recombinant Mouse Crmp1 Protein, Myc/DDK-tagged | +Inquiry |
CRMP1-2071HF | Recombinant Full Length Human CRMP1 Protein, GST-tagged | +Inquiry |
CRMP1-1811H | Recombinant Human CRMP1 Protein (Met1-Val250), His tagged | +Inquiry |
CRMP1-26625TH | Recombinant Human CRMP1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRMP1-7273HCL | Recombinant Human CRMP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CRMP1 Products
Required fields are marked with *
My Review for All CRMP1 Products
Required fields are marked with *
0
Inquiry Basket