Recombinant Full Length Human CRLF2 Protein, GST-tagged

• Cat.No.: CRLF2-2069HF
• Product Overview: Human CRLF2 full-length ORF (BAB15557.1, 1 a.a. - 232 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 232 amino acids
• Description: This gene encodes a member of the type I cytokine receptor family. The encoded protein is a receptor for thymic stromal lymphopoietin (TSLP). Together with the interleukin 7 receptor (IL7R), the encoded protein and TSLP activate STAT3, STAT5, and JAK2 pathways, which control processes such as cell proliferation and development of the hematopoietic system. Rearrangement of this gene with immunoglobulin heavy chain gene (IGH) on chromosome 14, or with P2Y purinoceptor 8 gene (P2RY8) on the same X or Y chromosomes is associated with B-progenitor acute lymphoblastic leukemia (ALL) and Down syndrome ALL. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Sep 2014]
• Molecular Mass: 53.1 kDa
• AA Sequence: MGRLVLLWGAAVFLLGGWMALGQGGAEGVQIQIIYFNLETVQVTWNASKYSRTNLTFHYRFNGDEAYDQCTNYLLQEGHTSGCLLDAEQRDDILYFSIRNGTHPVFTASRWMVYYLKPSSPKHVRFSWHQDAVTVTCSDLSYGDLLYEVQYRSPFDTEWQTQSRSVTQAGVQWCDLCLLQPSPPRFKRFSCLSLPSSWDYRHPPPRLANFCIISRDGVSPCWPGWSRTCDLR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CRLF2 cytokine receptor-like factor 2 [ Homo sapiens ]
• Official Symbol: CRLF2
• Synonyms: CRLF2; cytokine receptor-like factor 2; CRL2; TSLPR; IL-XR; TSLP receptor; P2RY8/CRLF2 fusion; cytokine receptor-like 2; cytokine receptor CRL2 precusor; thymic stromal lymphopoietin receptor; thymic stromal lymphopoietin protein receptor; thymic stromal-derived lymphopoietin receptor; CRLF2Y
• Gene ID: 64109
• mRNA Refseq: NM_001012288
• Protein Refseq: NP_001012288
• MIM: 300357
• UniProt ID: Q9HC73