Recombinant Full Length Human CRISP3 Protein, GST-tagged

• Cat.No.: CRISP3-2064HF
• Product Overview: Human CRISP3 full-length ORF (BAG36185.1, 1 a.a. - 245 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a member of the cysteine-rich secretory protein (CRISP) family within the CRISP, antigen 5 and pathogenesis-related 1 proteins superfamily. The encoded protein has an N-terminal CRISP, antigen 5 and pathogenesis-related 1 proteins domain, a hinge region, and a C-terminal ion channel regulator domain. This protein contains cysteine residues, located in both the N- and C-terminal domains, that form eight disulfide bonds, a distinguishing characteristic of this family. This gene is expressed in the male reproductive tract where it plays a role in sperm function and fertilization, and the female reproductive tract where it plays a role in endometrial receptivity for embryo implantation. This gene is upregulated in certain types of prostate cancer. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2016]
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 53.35 kDa
• Protein length: 245 amino acids
• AA Sequence: MTLFPVLLFLVAGLLPSFPANEDKDPAFTALLTTQTQVQREIVNKHNELRRAVSPPARNMLKMEWNKEAAANAQKWANQCNYRHSNPKDRMTSLKCGENLYMSSASSSWSQAIQSWFDEYNDFDFGVGPKTPNAVVGHYTQVVWYSSYLVGCGNAYCPNQKVLKYYYVCQYCPAGNWANRLYVPYEQGAPCASCPDNCDDGLCTNGCKYEDLYSNCKSLKLTLTCKHQLVRDSCKASCNCSNSIY
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CRISP3 cysteine-rich secretory protein 3 [ Homo sapiens ]
• Official Symbol: CRISP3
• Synonyms: Aeg2; CRS3; SGP28; CRISP-3; dJ442L6.3
• Gene ID: 10321
• mRNA Refseq: NM_001190986
• Protein Refseq: NP_001177915
• MIM: 618062
• UniProt ID: P54108