Recombinant Full Length Human CPSF3 Protein, C-Flag-tagged
Cat.No. : | CPSF3-699HFL |
Product Overview : | Recombinant Full Length Human CPSF3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the metallo-beta-lactamase family. The encoded protein is a 73kDa subunit of the cleavage and polyadenylation specificity factor and functions as an endonuclease that recognizes the pre-mRNA 3'-cleavage site AAUAAA prior to polyadenylation. It also cleaves after the pre-mRNA sequence ACCCA during histone 3'-end pre-mRNA processing. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 77.3 kDa |
AA Sequence : | MSAIPAEESDQLLIRPLGAGQEVGRSCIILEFKGRKIMLDCGIHPGLEGMDALPYIDLIDPAEIDLLLIS HFHLDHCGALPWFLQKTSFKGRTFMTHATKAIYRWLLSDYVKVSNISADDMLYTETDLEESMDKIETINF HEVKEVAGIKFWCYHAGHVLGAAMFMIEIAGVKLLYTGDFSRQEDRHLMAAEIPNIKPDILIIESTYGTH IHEKREEREARFCNTVHDIVNRGGRGLIPVFALGRAQELLLILDEYWQNHPELHDIPIYYASSLAKKCMA VYQTYVNAMNDKIRKQININNPFVFKHISNLKSMDHFDDIGPSVVMASPGMMQSGLSRELFESWCTDKRN GVIIAGYCVEGTLAKHIMSEPEEITTMSGQKLPLKMSVDYISFSAHTDYQQTSEFIRALKPPHVILVHGE QNEMARLKAALIREYEDNDEVHIEVHNPRNTEAVTLNFRGEKLAKVMGFLADKKPEQGQRVSGILVKRNF NYHILSPCDLSNYTDLAMSTVKQTQAIPYTGPFNLLCYQLQKLTGDVEELEIQEKPALKVFKNITVIQEP GMVVLEWLANPSNDMYADTVTTVILEVQSNPKIRKGAVQKVSKKLEMHVYSKRLEIMLQDIFGEDCVSVK DDSILSVTVDGKTANLNLETRTVECEEGSEDDESLREMVELAAQRLYEALTPVHTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | CPSF3 cleavage and polyadenylation specific factor 3 [ Homo sapiens (human) ] |
Official Symbol | CPSF3 |
Synonyms | CPSF73; NEDMHS; CPSF-73; NEDMHSN |
Gene ID | 51692 |
mRNA Refseq | NM_016207.4 |
Protein Refseq | NP_057291.1 |
MIM | 606029 |
UniProt ID | Q9UKF6 |
◆ Recombinant Proteins | ||
CPSF3-1812H | Recombinant Human CPSF3 Protein, GST-tagged | +Inquiry |
CPSF3-1458H | Recombinant Human CPSF3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CPSF3-2154HF | Recombinant Full Length Human CPSF3 Protein, GST-tagged | +Inquiry |
CPSF3-699HFL | Recombinant Full Length Human CPSF3 Protein, C-Flag-tagged | +Inquiry |
CPSF3-1127Z | Recombinant Zebrafish CPSF3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CPSF3-7304HCL | Recombinant Human CPSF3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CPSF3 Products
Required fields are marked with *
My Review for All CPSF3 Products
Required fields are marked with *
0
Inquiry Basket