Recombinant Full Length Human CPNE4 Protein, C-Flag-tagged
Cat.No. : | CPNE4-1408HFL |
Product Overview : | Recombinant Full Length Human CPNE4 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene belongs to the highly conserved copine family. It encodes a calcium-dependent, phospholipid-binding protein, which may be involved in membrane trafficking, mitogenesis and development. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 62.2 kDa |
AA Sequence : | MKKMSNIYESAANTLGIFNSPCLTKVELRVACKGISDRDALSKPDPCVILKMQSHGQWFEVDRTEVIRTC INPVYSKLFTVDFYFEEVQRLRFEVHDISSNHNGLKEADFLGGMECTLGQIVSQRKLSKSLLKHGNTAGK SSITVIAEELSGNDDYVELAFNARKLDDKDFFSKSDPFLEIFRMNDDATQQLVHRTEVVMNNLSPAWKSF KVSVNSLCSGDPDRRLKCIVWDWDSNGKHDFIGEFTSTFKEMRGAMEGKQVQWECINPKYKAKKKNYKNS GTVILNLCKIHKMHSFLDYIMGGCQIQFTVAIDFTASNGDPRNSCSLHYIHPYQPNEYLKALVAVGEICQ DYDSDKMFPAFGFGARIPPEYTVSHDFAINFNEDNPECAGIQGVVEAYQSCLPKLQLYGPTNIAPIIQKV AKSASEETNTKEASQYFILLILTDGVITDMADTREAIVHASHLPMSVIIVGVGNADFSDMQMLDGDDGIL RSPKGEPVLRDIVQFVPFRNFKHASPAALAKSVLAEVPNQVVDYYNGKGIKPKCSSEMYESSRTLAPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | CPNE4 copine 4 [ Homo sapiens (human) ] |
Official Symbol | CPNE4 |
Synonyms | CPN4; COPN4 |
Gene ID | 131034 |
mRNA Refseq | NM_130808.3 |
Protein Refseq | NP_570720.1 |
MIM | 604208 |
UniProt ID | Q96A23 |
◆ Recombinant Proteins | ||
CPNE4-1408HFL | Recombinant Full Length Human CPNE4 Protein, C-Flag-tagged | +Inquiry |
CPNE4-3849M | Recombinant Mouse CPNE4 Protein | +Inquiry |
Cpne4-2292M | Recombinant Mouse Cpne4 Protein, Myc/DDK-tagged | +Inquiry |
CPNE4-11528H | Recombinant Human CPNE4, His-tagged | +Inquiry |
CPNE4-1797H | Recombinant Human CPNE4 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CPNE4-7308HCL | Recombinant Human CPNE4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CPNE4 Products
Required fields are marked with *
My Review for All CPNE4 Products
Required fields are marked with *
0
Inquiry Basket