Recombinant Full Length Human COX7A1 Protein, GST-tagged

• Cat.No.: COX7A1-2014HF
• Product Overview: Human COX7A1 full-length ORF ( AAH02757, 1 a.a. - 79 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 79 amino acids
• Description: Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes polypeptide 1 (muscle isoform) of subunit VIIa and the polypeptide 1 is present only in muscle tissues. Other polypeptides of subunit VIIa are present in both muscle and nonmuscle tissues, and are encoded by different genes. [provided by RefSeq, Jul 2008]
• Molecular Mass: 34.43 kDa
• AA Sequence: MQALRVSQALIRSFSSTARNRFQNRVREKQKLFQEDNDIPLYLKGGIVDNILYRVTMTLCLGGTVYSLYSLGWASFPRN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: COX7A1 cytochrome c oxidase subunit 7A1 [ Homo sapiens (human) ]
• Official Symbol: COX7A1
• Synonyms: COX7A1; cytochrome c oxidase subunit 7A1; Cytochrome C Oxidase Subunit 7A1; Cytochrome C Oxidase Subunit VIIa Polypeptide 1 (Muscle); Cytochrome C Oxidase Subunit VIIa-H; Cytochrome C Oxidase Subunit VIIa-M; COX7AH; Cytochrome C Oxidase Subunit VIIa Heart/Muscle Isoform; Cytochrome C Oxidase Subunit 7A1, Mitochondrial; COX7AM; COX7A; cytochrome c oxidase subunit 7A1, mitochondrial; cytochrome c oxidase subunit VIIa heart/muscle isoform; cytochrome c oxidase subunit VIIa polypeptide 1 (muscle); cytochrome c oxidase subunit VIIa-H; cytochrome c oxidase subunit VIIa-M; cytochrome c oxidase subunit VIIa-heart; cytochrome c oxidase subunit VIIa-muscle; EC 1.9.3.1
• Gene ID: 1346
• mRNA Refseq: NM_001864
• Protein Refseq: NP_001855
• MIM: 123995
• UniProt ID: P24310