Recombinant Full Length Human COA1 Protein, GST-tagged

Cat.No. : COA1-4847HF
Product Overview : Human FLJ10803 full-length ORF ( AAH56884, 1 a.a. - 146 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 146 amino acids
Description : COA1 (Cytochrome C Oxidase Assembly Factor 1 Homolog) is a Protein Coding gene.
Molecular Mass : 41.8 kDa
AA Sequence : MMWQKYAGSRRSMPLGARILFHGVFYAGGFAIVYYLIQKFHSRALYYKLAVEQLQSHPEAQEALGPPLNIHYLKLIDRENFVDIVDAKLKIPVSGSKSKGLLYVHSSRGGPFQRWHLDEVFLELKDGQQIPVFKLSGENGDEVKKE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name COA1 cytochrome c oxidase assembly factor 1 homolog [ Homo sapiens (human) ]
Official Symbol COA1
Synonyms C7ORF44; chromosome 7 open reading frame 44; uncharacterized protein C7orf44; FLJ10803; COA1; cytochrome c oxidase assembly factor 1 homolog
Gene ID 55744
mRNA Refseq NM_018224
Protein Refseq NP_060694
MIM 614769
UniProt ID Q9GZY4

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All COA1 Products

Required fields are marked with *

My Review for All COA1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon