Recombinant Full Length Human CNOT8 Protein, GST-tagged

• Cat.No.: CNOT8-1911HF
• Product Overview: Human CNOT8 full-length ORF ( AAH17366, 1 a.a. - 292 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: CNOT8 (CCR4-NOT Transcription Complex Subunit 8) is a Protein Coding gene. Among its related pathways are Deadenylation-dependent mRNA decay and Gene Expression. GO annotations related to this gene include nucleic acid binding and RNA binding. An important paralog of this gene is CNOT7.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 57.86 kDa
• Protein length: 292 amino acids
• AA Sequence: MPAALVENSQVICEVWASNLEEEMRKIREIVLSYSYIAMDTEFPGVVVRPIGEFRSSIDYQYQLLRCNVDLLKIIQLGLTFTNEKGEYPSGINTWQFNFKFNLTEDMYSQDSIDLLANSGLQFQKHEEEGIDTLHFAELLTTSGVVLCDNVKWLSFHSGYDFGYMVKLLTDSRLPEEEHEFFHILNLFFPSIYDVKYLMKSCKNLKGGLQEVADQLDLQRIGRQHQAGSDSLLTGMAFFRMKELFFEDSIDDAKYCGRLYGLGTGVAQKQNEDVDSAQEKMSILAIINNMQQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CNOT8 CCR4-NOT transcription complex, subunit 8 [ Homo sapiens ]
• Official Symbol: CNOT8
• Synonyms: CNOT8; CCR4-NOT transcription complex, subunit 8; POP2; CCR4-NOT transcription complex subunit 8; CAF1; CALIF; hCAF1; PGK promoter directed over production; CAF2; CALIFp; CAF1-like protein; CCR4-associated factor 8
• Gene ID: 9337
• mRNA Refseq: NM_004779
• Protein Refseq: NP_004770
• MIM: 603731
• UniProt ID: Q9UFF9