Recombinant Full Length Human CMTM2 Protein, GST-tagged

• Cat.No.: CMTM2-1907HF
• Product Overview: Human CMTM2 full-length ORF ( NP_653274.1, 1 a.a. - 248 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 248 amino acids
• Description: This gene belongs to the chemokine-like factor gene superfamily, a novel family that links the chemokine and the transmembrane 4 superfamilies of signaling molecules. The protein encoded by this gene may play an important role in testicular development. [provided by RefSeq, Jul 2008]
• Molecular Mass: 53.9 kDa
• AA Sequence: MAPKAAKGAKPEPAPAPPPPGAKPEEDKKDGKEPSDKPQKAVQDHKEPSDKPQKAVQPKHEVGTRRGCRRYRWELKDSNKEFWLLGHAEIKIRSLGCLIAAMILLSSLTVHPILRLIITMEISFFSFFILLYSFAIHRYIPFILWPISDLFNDLIACAFLVGAVVFAVRSRRSMNLHYLLAVILIGAAGVFAFIDVCLQRNHFRGKKAKKHMLVPPPGKEKGPQQGKGPEPAKPPEPGKPPGPAKGKK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CMTM2 CKLF-like MARVEL transmembrane domain containing 2 [ Homo sapiens ]
• Official Symbol: CMTM2
• Synonyms: CMTM2; CKLF-like MARVEL transmembrane domain containing 2; chemokine like factor super family 2 , chemokine like factor superfamily 2 , CKLFSF2; CKLF-like MARVEL transmembrane domain-containing protein 2; FLJ25732; MGC39436; chemokine-like factor superfamily 2; chemokine-like factor superfamily member 2; CKLFSF2
• Gene ID: 146225
• mRNA Refseq: NM_001199317
• Protein Refseq: NP_001186246
• MIM: 607885
• UniProt ID: Q8TAZ6