Recombinant Full Length Human CMTM1 Protein, GST-tagged

Cat.No. : CMTM1-1906HF
Product Overview : Human CMTM1 full-length ORF ( NP_851787.1, 1 a.a. - 114 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 114 amino acids
Description : This gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and the transmembrane 4 superfamilies of signaling molecules. The protein encoded by this gene may play an important role in testicular development. Alternatively spliced transcript variants encoding different isoforms have been identified. Naturally occurring read-through transcription occurs between this locus and the neighboring locus CKLF (chemokine-like factor).[provided by RefSeq, Feb 2011]
Molecular Mass : 39 kDa
AA Sequence : MDPEHAKPESSEAPSGNLKQPETAAALSLILGALACFIITQANESFITITSLEICIVVFFILIYVLTLHHLLTYLHWPLLDLTNSIITAVFLSVVAILAMQEKKRRHLLYVGGR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CMTM1 CKLF-like MARVEL transmembrane domain containing 1 [ Homo sapiens ]
Official Symbol CMTM1
Synonyms CMTM1; CKLF-like MARVEL transmembrane domain containing 1; chemokine like factor super family 1 , chemokine like factor superfamily 1 , CKLFSF1; CKLF-like MARVEL transmembrane domain-containing protein 1; CKLFH; CKLFH1a; chemokine-like factor superfamily 1; chemokine-like factor super family 1; chemokine-like factor-like protein CKLFH1; chemokine-like factor superfamily member 1; CKLFH1; CKLFSF1; MGC71870
Gene ID 113540
mRNA Refseq NM_052999
Protein Refseq NP_443725
MIM 607884
UniProt ID Q8IZ96

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CMTM1 Products

Required fields are marked with *

My Review for All CMTM1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon