Recombinant Full Length Human CMTM1 Protein, GST-tagged

• Cat.No.: CMTM1-1906HF
• Product Overview: Human CMTM1 full-length ORF ( NP_851787.1, 1 a.a. - 114 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 114 amino acids
• Description: This gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and the transmembrane 4 superfamilies of signaling molecules. The protein encoded by this gene may play an important role in testicular development. Alternatively spliced transcript variants encoding different isoforms have been identified. Naturally occurring read-through transcription occurs between this locus and the neighboring locus CKLF (chemokine-like factor).[provided by RefSeq, Feb 2011]
• Molecular Mass: 39 kDa
• AA Sequence: MDPEHAKPESSEAPSGNLKQPETAAALSLILGALACFIITQANESFITITSLEICIVVFFILIYVLTLHHLLTYLHWPLLDLTNSIITAVFLSVVAILAMQEKKRRHLLYVGGR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CMTM1 CKLF-like MARVEL transmembrane domain containing 1 [ Homo sapiens ]
• Official Symbol: CMTM1
• Synonyms: CMTM1; CKLF-like MARVEL transmembrane domain containing 1; chemokine like factor super family 1 , chemokine like factor superfamily 1 , CKLFSF1; CKLF-like MARVEL transmembrane domain-containing protein 1; CKLFH; CKLFH1a; chemokine-like factor superfamily 1; chemokine-like factor super family 1; chemokine-like factor-like protein CKLFH1; chemokine-like factor superfamily member 1; CKLFH1; CKLFSF1; MGC71870
• Gene ID: 113540
• mRNA Refseq: NM_052999
• Protein Refseq: NP_443725
• MIM: 607884
• UniProt ID: Q8IZ96