Recombinant Full Length Human CMC2 Protein, GST-tagged

Cat.No. : CMC2-1902HF
Product Overview : Human CMC2 full-length ORF ( ABM81706.1, 1 a.a. - 79 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 79 amino acids
Description : CMC2 (C-X9-C Motif Containing 2) is a Protein Coding gene. Diseases associated with CMC2 include Neonatal Anemia. Among its related pathways are Metabolism of proteins and Mitochondrial protein import.
Molecular Mass : 35.09 kDa
AA Sequence : MHPDLSPHLHTEECNVLINLLKECHKNHNILKFFGYCNDVDRELRKCLKNEYVENRTKSREHGIAMRKKLFNPPEESEK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CMC2 COX assembly mitochondrial protein 2 homolog (S. cerevisiae) [ Homo sapiens ]
Official Symbol CMC2
Synonyms DC13; C16orf61; 2310061C15Rik
Gene ID 56942
mRNA Refseq NM_020188.3
Protein Refseq NP_064573.1
UniProt ID Q9NRP2

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CMC2 Products

Required fields are marked with *

My Review for All CMC2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon