Recombinant Full Length Human CMC2 Protein, GST-tagged

• Cat.No.: CMC2-1902HF
• Product Overview: Human CMC2 full-length ORF ( ABM81706.1, 1 a.a. - 79 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 79 amino acids
• Description: CMC2 (C-X9-C Motif Containing 2) is a Protein Coding gene. Diseases associated with CMC2 include Neonatal Anemia. Among its related pathways are Metabolism of proteins and Mitochondrial protein import.
• Molecular Mass: 35.09 kDa
• AA Sequence: MHPDLSPHLHTEECNVLINLLKECHKNHNILKFFGYCNDVDRELRKCLKNEYVENRTKSREHGIAMRKKLFNPPEESEK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CMC2 COX assembly mitochondrial protein 2 homolog (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: CMC2
• Synonyms: DC13; C16orf61; 2310061C15Rik
• Gene ID: 56942
• mRNA Refseq: NM_020188.3
• Protein Refseq: NP_064573.1
• UniProt ID: Q9NRP2