Recombinant Full Length Human CMC2 Protein, GST-tagged
Cat.No. : | CMC2-1902HF |
Product Overview : | Human CMC2 full-length ORF ( ABM81706.1, 1 a.a. - 79 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 79 amino acids |
Description : | CMC2 (C-X9-C Motif Containing 2) is a Protein Coding gene. Diseases associated with CMC2 include Neonatal Anemia. Among its related pathways are Metabolism of proteins and Mitochondrial protein import. |
Molecular Mass : | 35.09 kDa |
AA Sequence : | MHPDLSPHLHTEECNVLINLLKECHKNHNILKFFGYCNDVDRELRKCLKNEYVENRTKSREHGIAMRKKLFNPPEESEK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CMC2 COX assembly mitochondrial protein 2 homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | CMC2 |
Synonyms | DC13; C16orf61; 2310061C15Rik |
Gene ID | 56942 |
mRNA Refseq | NM_020188.3 |
Protein Refseq | NP_064573.1 |
UniProt ID | Q9NRP2 |
◆ Recombinant Proteins | ||
CMC2-727Z | Recombinant Zebrafish CMC2 | +Inquiry |
CMC2-8368Z | Recombinant Zebrafish CMC2 | +Inquiry |
CMC2-3612H | Recombinant Human CMC2 protein, His-tagged | +Inquiry |
CMC2-1536H | Recombinant Human CMC2 Protein, GST-tagged | +Inquiry |
CMC2-1902HF | Recombinant Full Length Human CMC2 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CMC2 Products
Required fields are marked with *
My Review for All CMC2 Products
Required fields are marked with *
0
Inquiry Basket