Recombinant Full Length Human CLLU1OS Protein, GST-tagged
Cat.No. : | CLLU1OS-1877HF |
Product Overview : | Human CLLU1OS full-length ORF ( AAI53087.1, 1 a.a. - 101 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 101 amino acids |
Description : | CLLU1OS (Chronic Lymphocytic Leukemia Up-Regulated 1 Opposite Strand) is a Protein Coding gene. Diseases associated with CLLU1OS include Chronic Lymphocytic Leukemia. |
Molecular Mass : | 38.06 kDa |
AA Sequence : | MNKLGHNELKECLKTATDSLQTVQPSISQTCTSYGPALGAPLPGRNEVALLTSLPPNYEISEGKPRAISAYVRAGKGNVTRRRKKTHLGNDDGKKEAQEKM |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CLLU1OS chronic lymphocytic leukemia up-regulated 1 opposite strand [ Homo sapiens (human) ] |
Official Symbol | CLLU1OS |
Synonyms | CLLU1OS; chronic lymphocytic leukemia up-regulated 1 opposite strand; Chronic Lymphocytic Leukemia Up-Regulated 1 Opposite Strand; Chronic Lymphocytic Leukemia Up-Regulated 1 Overlapping Strand; putative chronic lymphocytic leukemia up-regulated protein 1 opposite strand transcript protein |
Gene ID | 574016 |
mRNA Refseq | NM_001025232 |
Protein Refseq | NP_001020403 |
MIM | 616989 |
UniProt ID | Q5K130 |
◆ Recombinant Proteins | ||
CLLU1OS-1877HF | Recombinant Full Length Human CLLU1OS Protein, GST-tagged | +Inquiry |
CLLU1OS-1504H | Recombinant Human CLLU1OS Protein, GST-tagged | +Inquiry |
CLLU1OS-3256H | Recombinant Human CLLU1OS Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CLLU1OS Products
Required fields are marked with *
My Review for All CLLU1OS Products
Required fields are marked with *
0
Inquiry Basket