Recombinant Full Length Human CLGN Protein, GST-tagged
Cat.No. : | CLGN-2174HF |
Product Overview : | Human CLGN full-length ORF ( NP_004353.1, 1 a.a. - 610 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 610 amino acids |
Description : | Calmegin is a testis-specific endoplasmic reticulum chaperone protein. CLGN may play a role in spermatogeneisis and infertility. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 96.4 kDa |
AA Sequence : | MHFQAFWLCLGLLFISINAEFMDDDVETEDFEENSEEIDVNESELSSEIKYKTPQPIGEVYFAETFDSGRLAGWVLSKAKKDDMDEEISIYDGRWEIEELKENQVPGDRGLVLKSRAKHHAISAVLAKPFIFADKPLIVQYEVNFQDGIDCGGAYIKLLADTDDLILENFYDKTSYIIMFGPDKCGEDYKLHFIFRHKHPKTGVFEEKHAKPPDVDLKKFFTDRKTHLYTLVMNPDDTFEVLVDQTVVNKGSLLEDVVPPIKPPKEIEDPNDKKPEEWDERAKIPDPSAVKPEDWDESEPAQIEDSSVVKPAGWLDDEPKFIPDPNAEKPDDWNEDTDGEWEAPQILNPACRIGCGEWKPPMIDNPKYKGVWRPPLVDNPNYQGIWSPRKIPNPDYFEDDHPFLLTSFSALGLELWSMTSDIYFDNFIICSEKEVADHWAADGWRWKIMIANANKPGVLKQLMAAAEGHPWLWLIYLVTAGVPIALITSFCWPRKVKKKHKDTEYKKTDICIPQTKGVLEQEEKEEKAALEKPMDLEEEKKQNDGEMLEKEEESEPEEKSEEEIEIIEGQEESNQSNKSGSEDEMKEADESTGSGDGPIKSVRKRRVRKD |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CLGN calmegin [ Homo sapiens ] |
Official Symbol | CLGN |
Synonyms | CLGN; calmegin |
Gene ID | 1047 |
mRNA Refseq | NM_001130675 |
Protein Refseq | NP_001124147 |
MIM | 601858 |
UniProt ID | O14967 |
◆ Recombinant Proteins | ||
RFL22812MF | Recombinant Full Length Mouse Calmegin(Clgn) Protein, His-Tagged | +Inquiry |
CLGN-1752M | Recombinant Mouse CLGN Protein, His (Fc)-Avi-tagged | +Inquiry |
CLGN-52H | Recombinant Human CLGN, His-tagged | +Inquiry |
RFL19240HF | Recombinant Full Length Human Calmegin(Clgn) Protein, His-Tagged | +Inquiry |
CLGN-1690H | Recombinant Human CLGN Protein (Met1-Trp471), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLGN-7449HCL | Recombinant Human CLGN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CLGN Products
Required fields are marked with *
My Review for All CLGN Products
Required fields are marked with *
0
Inquiry Basket