Recombinant Full Length Human Calmegin(Clgn) Protein, His-Tagged
Cat.No. : | RFL19240HF |
Product Overview : | Recombinant Full Length Human Calmegin(CLGN) Protein (O14967) (20-610aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (20-610) |
Form : | Lyophilized powder |
AA Sequence : | EFMDDDVETEDFEENSEEIDVNESELSSEIKYKTPQPIGEVYFAETFDSGRLAGWVLSKAKKDDMDEEISIYDGRWEIEELKENQVPGDRGLVLKSRAKHHAISAVLAKPFIFADKPLIVQYEVNFQDGIDCGGAYIKLLADTDDLILENFYDKTSYIIMFGPDKCGEDYKLHFIFRHKHPKTGVFEEKHAKPPDVDLKKFFTDRKTHLYTLVMNPDDTFEVLVDQTVVNKGSLLEDVVPPIKPPKEIEDPNDKKPEEWDERAKIPDPSAVKPEDWDESEPAQIEDSSVVKPAGWLDDEPKFIPDPNAEKPDDWNEDTDGEWEAPQILNPACRIGCGEWKPPMIDNPKYKGVWRPPLVDNPNYQGIWSPRKIPNPDYFEDDHPFLLTSFSALGLELWSMTSDIYFDNFIICSEKEVADHWAADGWRWKIMIANANKPGVLKQLMAAAEGHPWLWLIYLVTAGVPIALITSFCWPRKVKKKHKDTEYKKTDICIPQTKGVLEQEEKEEKAALEKPMDLEEEKKQNDGEMLEKEEESEPEEKSEEEIEIIEGQEESNQSNKSGSEDEMKEADESTGSGDGPIKSVRKRRVRKD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CLGN |
Synonyms | CLGN; Calmegin |
UniProt ID | O14967 |
◆ Recombinant Proteins | ||
CLGN-1691H | Recombinant Human CLGN Protein (Pro493-Asp610), N-His tagged | +Inquiry |
CLGN-52H | Recombinant Human CLGN, His-tagged | +Inquiry |
CLGN-11323H | Recombinant Human CLGN, GST-tagged | +Inquiry |
CLGN-1035H | Recombinant Human CLGN Protein (Glu20-Trp471), C-His tagged | +Inquiry |
CLGN-1690H | Recombinant Human CLGN Protein (Met1-Trp471), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLGN-7449HCL | Recombinant Human CLGN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CLGN Products
Required fields are marked with *
My Review for All CLGN Products
Required fields are marked with *
0
Inquiry Basket