Recombinant Full Length Human CLEC18C Protein, GST-tagged

Cat.No. : CLEC18C-6393HF
Product Overview : Human MGC34761 full-length ORF ( AAH39068.1, 1 a.a. - 301 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 301 amino acids
Description : CLEC18C (C-Type Lectin Domain Family 18 Member C) is a Protein Coding gene. Diseases associated with CLEC18C include Atypical Lipomatous Tumor. Among its related pathways are Sertoli-Sertoli Cell Junction Dynamics and Actin Nucleation by ARP-WASP Complex. GO annotations related to this gene include carbohydrate binding. An important paralog of this gene is CLEC18A.
Molecular Mass : 59.5 kDa
AA Sequence : MAGALNRKESFLLLSLHNRLRSWVQPPAADRRRLDWSDSLAQLAQARAALCGIPTPSLASGLWRTLQVGWNMQLLPAGLASFVEVVSLWFAEGQRYSHAAGECARNATCTHYTQLVWATSSQLGCGRHLCSAGQAAIEAFVCAYSPRGNWEVNGKTIVPYKKGAWCSLCTASVSGCFKAWDHAGGLCEVPRNPCRMSCQNHGRLNISTCHCHCPPGYTGRYCQVRCSLQCVHGRFREEECSCVCDIGYGGAQCATKVHFPFHTCDLRIDGDCFMVSSEADTYYRARMKCQVTVTPSFLGTP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CLEC18C C-type lectin domain family 18 member C [ Homo sapiens (human) ]
Official Symbol CLEC18C
Synonyms CLEC18C; C-type lectin domain family 18 member C; MRCL; MRCL3; C-type lectin domain family 18 member C; mannose receptor-like 3; mannose receptor-like protein 3
Gene ID 283971
mRNA Refseq NM_173619
Protein Refseq NP_775890
MIM 616573
UniProt ID Q8NCF0

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CLEC18C Products

Required fields are marked with *

My Review for All CLEC18C Products

Required fields are marked with *

0

Inquiry Basket

cartIcon