Recombinant Full Length Human CLEC11A Protein, GST-tagged

• Cat.No.: CLEC11A-2114HF
• Product Overview: Human CLEC11A full-length ORF (BAG36831.1, 1 a.a. - 323 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a member of the C-type lectin superfamily. The encoded protein is a secreted sulfated glycoprotein and functions as a growth factor for primitive hematopoietic progenitor cells. An alternative splice variant has been described but its biological nature has not been determined. [provided by RefSeq, Jul 2008]
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 61.93 kDa
• Protein length: 323 amino acids
• AA Sequence: MQAAWLLGALVVPQLLGFGHGARGAEREWEGGWGGAQEEEREREALMLKHLQEALGLPAGRGDENPAGTVEGKEDWEMEEDQGEEEEEEATPTPSSGPSPSPTPEDIVTYILGRLAGLDAGLHQLHVRLHALDTRVVELTQGLRQLRNAAGDTRDAVQALQEAQGRAEREHGRLEGCLKGLRLGHKCFLLSRDFEAQAAAQARCTARGGSLAQPADRQQMEALTRYLRAALAPYNWPVWLGVHDRRAEGLYLFENGQRVSFFAWHRSPRPELGAQPSASPHPLSPDQPNGGTLENCVAQASDDGSWWDHDCQRRLYYVCEFPF
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CLEC11A C-type lectin domain family 11, member A [ Homo sapiens ]
• Official Symbol: CLEC11A
• Synonyms: CLEC11A; C-type lectin domain family 11, member A; SCGF, stem cell growth factor; lymphocyte secreted C type lectin; C-type lectin domain family 11 member A; CLECSF3; LSLCL; P47; stem cell growth factor; lymphocyte secreted C-type lectin; C-type lectin superfamily member 3; lymphocyte secreted long form of C-type lectin; C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 3; SCGF
• Gene ID: 6320
• mRNA Refseq: NM_002975
• Protein Refseq: NP_002966
• MIM: 604713
• UniProt ID: Q9Y240