Recombinant Full Length Human CLDND2 Protein, GST-tagged

• Cat.No.: CLDND2-6188HF
• Product Overview: Human MGC33839 full-length ORF ( NP_689566.1, 1 a.a. - 167 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: CLDND2 (Claudin Domain Containing 2) is a Protein Coding gene. An important paralog of this gene is ENSG00000269403.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 44.4 kDa
• Protein length: 167 amino acids
• AA Sequence: MGVKRSLQSGGILLSLVANVLMVLSTATNYWTRQQEGHSGLWQECNHGICSSIPCQTTLAVTVACMVLAVGVGVVGMVMGLRIRCDEGESLRGQTTSAFLFLGGLLLLTALIGYTVKNAWKNNVFFSWSYFSGWLALPFSILAGFCFLLADMIMQSTDAISGFPVCL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CLDND2 claudin domain containing 2 [ Homo sapiens ]
• Official Symbol: CLDND2
• Synonyms: CLDND2; claudin domain containing 2; claudin domain-containing protein 2; MGC33839
• Gene ID: 125875
• mRNA Refseq: NM_152353
• Protein Refseq: NP_689566
• UniProt ID: Q8NHS1