Recombinant Full Length Human CLDN15 Protein, GST-tagged

• Cat.No.: CLDN15-2042HF
• Product Overview: Human CLDN15 full-length ORF ( AAH10160, 1 a.a. - 128 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 128 amino acids
• Description: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. Alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jun 2010]
• Molecular Mass: 39.82 kDa
• AA Sequence: MSMAVETFGFFMATVGLLMLGVTLPNSYWRVSTVHGNVITTNTIFENLWFSCATDSLGVYNCWEFPSMLALSGSTDSPASLSGGTGLLVRLMSIKGPCEGRRLASCRLSVRCKEAVCVQGIFRPAGHS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CLDN15 claudin 15 [ Homo sapiens ]
• Official Symbol: CLDN15
• Synonyms: CLDN15; claudin 15; claudin-15; FLJ42715; MGC19536
• Gene ID: 24146
• mRNA Refseq: NM_001185080
• Protein Refseq: NP_001172009
• MIM: 615778
• UniProt ID: P56746