Recombinant Full Length Human Claudin-18(Cldn18) Protein, His-Tagged
Cat.No. : | RFL6794HF |
Product Overview : | Recombinant Full Length Human Claudin-18(CLDN18) Protein (P56856) (1-261aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-261) |
Form : | Lyophilized powder |
AA Sequence : | MSTTTCQVVAFLLSILGLAGCIAATGMDMWSTQDLYDNPVTSVFQYEGLWRSCVRQSSGF TECRPYFTILGLPAMLQAVRALMIVGIVLGAIGLLVSIFALKCIRIGSMEDSAKANMTLT SGIMFIVSGLCAIAGVSVFANMLVTNFWMSTANMYTGMGGMVQTVQTRYTFGAALFVGWV AGGLTLIGGVMMCIACRGLAPEETNYKAVSYHASGHSVAYKPGGFKASTGFGSNTKNKKI YDGGARTEDEVQSYPSKHDYV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CLDN18 |
Synonyms | CLDN18; UNQ778/PRO1572; Claudin-18 |
UniProt ID | P56856 |
◆ Recombinant Proteins | ||
SLC39A6-0347H | Active Recombinant Human SLC39A6 protein, His-Avi-tagged, Biotinylated | +Inquiry |
SYT2-16334M | Recombinant Mouse SYT2 Protein | +Inquiry |
RFL13229SF | Recombinant Full Length Staphylococcus Aureus Atp Synthase Subunit A(Atpb) Protein, His-Tagged | +Inquiry |
IL21-2065R | Recombinant Rhesus Macaque IL21 Protein, His (Fc)-Avi-tagged | +Inquiry |
APBB1IP-1501C | Recombinant Chicken APBB1IP | +Inquiry |
◆ Native Proteins | ||
Lectin-1835R | Native Ricinus Communis Ricin A Chain Protein | +Inquiry |
APOA2-4772H | Native Human Apolipoprotein AII protein | +Inquiry |
FBa-12H | Native Human Factor Ba protein | +Inquiry |
TRPM2-8463H | Native Human TRPM2 | +Inquiry |
Lectin-1862W | Active Native Wheat Germ Agglutinin Protein, Rhodamine labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
NMU-3781HCL | Recombinant Human NMU 293 Cell Lysate | +Inquiry |
ZNF697-2078HCL | Recombinant Human ZNF697 cell lysate | +Inquiry |
AIPL1-8949HCL | Recombinant Human AIPL1 293 Cell Lysate | +Inquiry |
ARHGAP5-8737HCL | Recombinant Human ARHGAP5 293 Cell Lysate | +Inquiry |
CARTPT-911HCL | Recombinant Human CARTPT cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All CLDN18 Products
Required fields are marked with *
My Review for All CLDN18 Products
Required fields are marked with *
0
Inquiry Basket