Recombinant Full Length Human Clarin-2(Clrn2) Protein, His-Tagged
Cat.No. : | RFL11074HF |
Product Overview : | Recombinant Full Length Human Clarin-2(CLRN2) Protein (A0PK11) (1-232aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-232) |
Form : | Lyophilized powder |
AA Sequence : | MPGWFKKAWYGLASLLSFSSFILIIVALVVPHWLSGKILCQTGVDLVNATDRELVKFIGD IYYGLFRGCKVRQCGLGGRQSQFTIFPHLVKELNAGLHVMILLLLFLALALALVSMGFAI LNMIQVPYRAVSGPGGICLWNVLAGGVVALAIASFVAAVKFHDLTERIANFQEKLFQFVV VEEQYEESFWICVASASAHAANLVVVAISQIPLPEIKTKIEEATVTAEDILY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CLRN2 |
Synonyms | CLRN2; Clarin-2 |
UniProt ID | A0PK11 |
◆ Native Proteins | ||
Collagen Type Ⅱ-525B | Native Bovine Type Collagen Type Ⅱ Protein | +Inquiry |
TI-50S | Active Native Soybean Trypsin Inhibitor | +Inquiry |
Batroxobin-99 | Native Bothrops atrox snake venom Batroxobin Protein | +Inquiry |
CGB-359H | Native Human Chorionic Gonadotropin, Beta Polypeptide | +Inquiry |
VTN -33B | Native Bovine multimeric vitronectin | +Inquiry |
◆ Cell & Tissue Lysates | ||
HEMK1-5587HCL | Recombinant Human HEMK1 293 Cell Lysate | +Inquiry |
NME1-3792HCL | Recombinant Human NME1 293 Cell Lysate | +Inquiry |
Skin-544E | Equine Skin Lysate, Total Protein | +Inquiry |
CPB1-3029HCL | Recombinant Human CPB1 cell lysate | +Inquiry |
CINP-7493HCL | Recombinant Human CINP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CLRN2 Products
Required fields are marked with *
My Review for All CLRN2 Products
Required fields are marked with *
0
Inquiry Basket