Recombinant Full Length Human CITED2 Protein, GST-tagged

• Cat.No.: CITED2-1858HF
• Product Overview: Human CITED2 full-length ORF ( NP_006070.2, 1 a.a. - 270 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The protein encoded by this gene inhibits transactivation of HIF1A-induced genes by competing with binding of hypoxia-inducible factor 1-alpha to p300-CH1. Mutations in this gene are a cause of cardiac septal defects. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, May 2012]
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 54.9 kDa
• Protein length: 270 amino acids
• AA Sequence: MADHMMAMNHGRFPDGTNGLHHHPAHRMGMGQFPSPHHHQQQQPQHAFNALMGEHIHYGAGNMNATSGIRHAMGPGTVNGGHPPSALAPAARFNNSQFMGPPVASQGGSLPASMQLQKLNNQYFNHHPYPHNHYMPDLHPAAGHQMNGTNQHFRDCNPKHSGGSSTPGGSGGSSTPGGSGSSSGGGAGSSNSGGGSGSGNMPASVAHVPAAMLPPNVIDTDFIDEEVLMSLVIEMGLDRIKELPELWLGQNEFDFMTDFVCKQQPSRVSC
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CITED2 Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 2 [ Homo sapiens ]
• Official Symbol: CITED2
• Synonyms: CITED2; Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 2; cbp/p300-interacting transactivator 2; MRG1; MRG-1; MSG1-related gene 1; MSG-related protein 1; melanocyte-specific gene 1-related gene 1; ASD8; VSD2; P35SRJ
• Gene ID: 10370
• mRNA Refseq: NM_001168388
• Protein Refseq: NP_001161860
• MIM: 602937
• UniProt ID: Q99967