Recombinant Full Length Human CITED1 Protein, GST-tagged

• Cat.No.: CITED1-1857HF
• Product Overview: Human CITED1 full-length ORF ( AAH04240, 1 a.a. - 193 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a member of the CREB-binding protein/p300-interacting transactivator with Asp/Glu-rich C-terminal domain (CITED) family of proteins. The encoded protein, also known as melanocyte-specific gene 1, may function as a transcriptional coactivator and may play a role in pigmentation of melanocytes. Alternatively spliced transcript variants have been described. [provided by RefSeq, Jan 2009]
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 46.97 kDa
• Protein length: 193 amino acids
• AA Sequence: MPTTSRPALDVKGGTSPAKEDANQEMSSVAYSNLAVKDRKAVAILHYPGVASNGTKASGAPTSSSGSPIGSPTTTPPTKPPSFNLHPAPHLLASMQLQKLNSQYQGMAAATPGQPGEAGPLQNWDFGAQAGGAESLSPSAGAQSPAIIDSDPVDEEVLMSLVVELGLDRANELPELWLGQNEFDFTADFPSSC
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CITED1 Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 1 [ Homo sapiens ]
• Official Symbol: CITED1
• Synonyms: CITED1; Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 1; MSG1; cbp/p300-interacting transactivator 1; melanocyte-specific gene 1; melanocyte-specific protein 1
• Gene ID: 4435
• mRNA Refseq: NM_001144885
• Protein Refseq: NP_001138357
• MIM: 300149
• UniProt ID: Q99966