Recombinant Full Length Human CHRNA7 Protein

• Cat.No.: CHRNA7-83HF
• Product Overview: Recombinant Human full length Nicotinic Acetylcholine Receptor alpha 7 protein with a proprietary N-terminal tag; molecular weight 61.05 kDa inclusive of tag

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Protein Length: 321 amino acids
• Description: The nicotinic acetylcholine receptors (nAChRs) are members of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. The nAChRs are thought to be hetero-pentamers composed of homologous subunits. The proposed structure for each subunit is a conserved N-terminal extracellular domain followed by three conserved transmembrane domains, a variable cytoplasmic loop, a fourth conserved transmembrane domain, and a short C-terminal extracellular region. The protein encoded by this gene forms a homo-oligomeric channel, displays marked permeability to calcium ions and is a major component of brain nicotinic receptors that are blocked by, and highly sensitive to, alpha-bungarotoxin. Once this receptor binds acetylcholine, it undergoes an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. This gene is located in a region identified as a major susceptibility locus for juvenile myoclonic epilepsy and a chromosomal location involved in the genetic transmission of schizophrenia. An evolutionarily recent partial duplication event in this region results in a hybrid containing sequence from this gene and a novel FAM7A gene. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
• Form: Liquid
• Molecular Mass: 61.050kDa inclusive of tags
• AA Sequence: MQEADISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVT FTVTMRRRTLYYGLSLLIPCVLISALALLVFLLPADSGEK ISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTM ITVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAW FLRMKRPGEDKVRPACQHKQRRCSLASVEMSAVAPPPASN GNLLYIGFRGLDGVHCVPTPDSGVVCGRMACSPTHDEHLL HGGQPPEGDPDLAKILEEVRYIANRFRCQDESEAVCSEWK FAACVVDRLCLMAFSVFTIICTIGILMSAPNFVEAVSKDF A
• Purity: Proprietary Purification
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
• Storage Buffer: pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.

Gene Information

• Gene Name: CHRNA7 cholinergic receptor, nicotinic, alpha 7 [ Homo sapiens ]
• Official Symbol: CHRNA7
• Synonyms: CHRNA7; cholinergic receptor, nicotinic, alpha 7; cholinergic receptor, nicotinic, alpha polypeptide 7; neuronal acetylcholine receptor subunit alpha-7
• Gene ID: 1139
• mRNA Refseq: NM_000746
• Protein Refseq: NP_000737
• MIM: 118511
• UniProt ID: P36544