Recombinant Full Length Human CHRNA7 Protein
Cat.No. : | CHRNA7-83HF |
Product Overview : | Recombinant Human full length Nicotinic Acetylcholine Receptor alpha 7 protein with a proprietary N-terminal tag; molecular weight 61.05 kDa inclusive of tag |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 321 amino acids |
Description : | The nicotinic acetylcholine receptors (nAChRs) are members of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. The nAChRs are thought to be hetero-pentamers composed of homologous subunits. The proposed structure for each subunit is a conserved N-terminal extracellular domain followed by three conserved transmembrane domains, a variable cytoplasmic loop, a fourth conserved transmembrane domain, and a short C-terminal extracellular region. The protein encoded by this gene forms a homo-oligomeric channel, displays marked permeability to calcium ions and is a major component of brain nicotinic receptors that are blocked by, and highly sensitive to, alpha-bungarotoxin. Once this receptor binds acetylcholine, it undergoes an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. This gene is located in a region identified as a major susceptibility locus for juvenile myoclonic epilepsy and a chromosomal location involved in the genetic transmission of schizophrenia. An evolutionarily recent partial duplication event in this region results in a hybrid containing sequence from this gene and a novel FAM7A gene. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
Form : | Liquid |
Molecular Mass : | 61.050kDa inclusive of tags |
AA Sequence : | MQEADISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVT FTVTMRRRTLYYGLSLLIPCVLISALALLVFLLPADSGEK ISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTM ITVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAW FLRMKRPGEDKVRPACQHKQRRCSLASVEMSAVAPPPASN GNLLYIGFRGLDGVHCVPTPDSGVVCGRMACSPTHDEHLL HGGQPPEGDPDLAKILEEVRYIANRFRCQDESEAVCSEWK FAACVVDRLCLMAFSVFTIICTIGILMSAPNFVEAVSKDF A |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | CHRNA7 cholinergic receptor, nicotinic, alpha 7 [ Homo sapiens ] |
Official Symbol | CHRNA7 |
Synonyms | CHRNA7; cholinergic receptor, nicotinic, alpha 7; cholinergic receptor, nicotinic, alpha polypeptide 7; neuronal acetylcholine receptor subunit alpha-7 |
Gene ID | 1139 |
mRNA Refseq | NM_000746 |
Protein Refseq | NP_000737 |
MIM | 118511 |
UniProt ID | P36544 |
◆ Recombinant Proteins | ||
CHRNA7-689R | Recombinant Rhesus Macaque CHRNA7 Protein, His (Fc)-Avi-tagged | +Inquiry |
CHRNA7-526H | Recombinant Human CHRNA7 protein, His-GST-tagged | +Inquiry |
CHRNA7-863R | Recombinant Rhesus monkey CHRNA7 Protein, His-tagged | +Inquiry |
CHRNA7-5755C | Recombinant Chicken CHRNA7 | +Inquiry |
CHRNA7-1667M | Recombinant Mouse CHRNA7 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHRNA7-7514HCL | Recombinant Human CHRNA7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CHRNA7 Products
Required fields are marked with *
My Review for All CHRNA7 Products
Required fields are marked with *
0
Inquiry Basket