Recombinant Full Length Human CHMP4C Protein, C-Flag-tagged
Cat.No. : | CHMP4C-1711HFL |
Product Overview : | Recombinant Full Length Human CHMP4C Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | CHMP4C belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. These proteins are components of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in degradation of surface receptor proteins and formation of endocytic multivesicular bodies (MVBs). Some CHMPs have both nuclear and cytoplasmic/vesicular distributions, and one such CHMP, CHMP1A, is required for both MVB formation and regulation of cell cycle progression. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 26.2 kDa |
AA Sequence : | MSKLGKFFKGGGSSKSRAAPSPQEALVRLRETEEMLGKKQEYLENRIQREIALAKKHGTQNKRAALQALK RKKRFEKQLTQIDGTLSTIEFQREALENSHTNTEVLRNMGFAAKAMKSVHENMDLNKIDDLMQEITEQQD IAQEISEAFSQRVGFGDDFDEDELMAELEELEQEELNKKMTNIRLPNVPSSSLPAQPNRKPGMSSTARRS RAASSQRAEEEDDDIKQLAAWATTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Endocytosis |
Full Length : | Full L. |
Gene Name | CHMP4C charged multivesicular body protein 4C [ Homo sapiens (human) ] |
Official Symbol | CHMP4C |
Synonyms | Shax3; SNF7-3; VPS32C |
Gene ID | 92421 |
mRNA Refseq | NM_152284.4 |
Protein Refseq | NP_689497.1 |
MIM | 610899 |
UniProt ID | Q96CF2 |
◆ Recombinant Proteins | ||
CHMP4C-3409M | Recombinant Mouse CHMP4C Protein | +Inquiry |
Chmp4c-2150M | Recombinant Mouse Chmp4c Protein, Myc/DDK-tagged | +Inquiry |
CHMP4C-4331C | Recombinant Chicken CHMP4C | +Inquiry |
CHMP4C-602H | Recombinant Human CHMP4C Protein, His (Fc)-Avi-tagged | +Inquiry |
CHMP4C-2568Z | Recombinant Zebrafish CHMP4C | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHMP4C-7531HCL | Recombinant Human CHMP4C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CHMP4C Products
Required fields are marked with *
My Review for All CHMP4C Products
Required fields are marked with *
0
Inquiry Basket