Recombinant Full Length Human CHMP2B Protein, GST-tagged

Cat.No. : CHMP2B-3206HF
Product Overview : Human CHMP2B full-length ORF (AAH01553.1, 1 a.a. - 213 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 213 amino acids
Description : This gene encodes a component of the heteromeric ESCRT-III complex (Endosomal Sorting Complex Required for Transport III) that functions in the recycling or degradation of cell surface receptors. ESCRT-III functions in the concentration and invagination of ubiquitinated endosomal cargos into intralumenal vesicles. The protein encoded by this gene is found as a monomer in the cytosol or as an oligomer in ESCRT-III complexes on endosomal membranes. It is expressed in neurons of all major regions of the brain. Mutations in this gene result in one form of familial frontotemporal lobar degeneration. [provided by RefSeq, Jul 2008]
Molecular Mass : 49.17 kDa
AA Sequence : MASLFKKKTVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQLELEIKKMAKIGNKEACKVLAKQLVHLRKQKTRTFAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEEMINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAKAPSAARSLPSASTSKATISDEEIERQLKALGVD
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CHMP2B charged multivesicular body protein 2B [ Homo sapiens ]
Official Symbol CHMP2B
Synonyms CHMP2B; charged multivesicular body protein 2B; chromatin modifying protein 2B; charged multivesicular body protein 2b; CHMP2.5; DKFZP564O123; VPS2 homolog B (S. cerevisiae); VPS2B; VPS2 homolog B; vacuolar protein-sorting-associated protein 2-2; DMT1; VPS2-2; DKFZp564O123;
Gene ID 25978
mRNA Refseq NM_001244644
Protein Refseq NP_001231573
MIM 609512
UniProt ID Q9UQN3

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CHMP2B Products

Required fields are marked with *

My Review for All CHMP2B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon