Recombinant Full Length Human CHIC2 Protein, GST-tagged

• Cat.No.: CHIC2-3198HF
• Product Overview: Human CHIC2 full-length ORF (AAH34691, 1 a.a. - 165 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 165 amino acids
• Description: This gene encodes a member of the CHIC family of proteins. The encoded protein contains a cysteine-rich hydrophobic (CHIC) motif, and is localized to vesicular structures and the plasma membrane. This gene is associated with some cases of acute myeloid leukemia. [provided by RefSeq, Jul 2008]
• Molecular Mass: 43.78 kDa
• AA Sequence: MADFDEIYEEEEDEERALEEQLLKYSPDPVVVRGSGHVTVFGLSNKFESEFPSSLTGKVAPEEFKASINRVNSCLKKNLPVNVRWLLCGCLCCCCTLGCSMWPVICLSKRTRRSIEKLLEWENNRLYHKLCLHWRLSKRKCETNNMMEYVILIEFLPKTPIFRPD
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CHIC2 cysteine-rich hydrophobic domain 2 [ Homo sapiens ]
• Official Symbol: CHIC2
• Synonyms: CHIC2; cysteine-rich hydrophobic domain 2; cysteine-rich hydrophobic domain 2 protein; BTL; BRX-like translocated in leukemia; cystein-rich hydrophobic domain 2; MGC21173
• Gene ID: 26511
• mRNA Refseq: NM_012110
• Protein Refseq: NP_036242
• MIM: 604332
• UniProt ID: Q9UKJ5