Recombinant Full Length Human CHD9 Protein, GST-tagged

Description :	CHD9 (Chromodomain Helicase DNA Binding Protein 9) is a Protein Coding gene. Among its related pathways are Mitochondrial Gene Expression and Regulation of lipid metabolism by Peroxisome proliferator-activated receptor alpha (PPARalpha). GO annotations related to this gene include nucleic acid binding and helicase activity. An important paralog of this gene is CHD7.
Source :	In Vitro Cell Free System
Species :	Human
Tag :	GST
Molecular Mass :	38.83 kDa
Protein length :	119 amino acids
AA Sequence :	MLINLLVAQLNMCYLHTLSLIVLQSIPKTNPMVCFQMYQMAVQCGAIRQLLPFQIKMDLLFTNKDIHTLCIKIKALWHTMTLPYFRPMNNKHSVLHYAHNKTEIISTQGRILLASLKIL
Applications :	Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array
Notes :	Best use within three months from the date of receipt of this protein.
Storage :	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Name	CHD9 chromodomain helicase DNA binding protein 9 [ Homo sapiens ]
Official Symbol	CHD9
Synonyms	CHD9; chromodomain helicase DNA binding protein 9; chromodomain-helicase-DNA-binding protein 9; BC022889; FLJ12178; KIAA0308; CHD-9; proteinx0008; kismet homolog 2; ATP-dependent helicase CHD9; ciprofibrate bound protein p240; chromatin remodeling factor CHROM1; chromatin-remodeling factor CHROM1; chromatin-related mesenchymal modulator; PPAR{gamma}-interacting cofactor 320 kDa; PPAR-alpha-interacting complex protein 320 kDa; peroxisomal proliferator-activated receptor A-interacting complex 320 kDa protein; AD013; CReMM; KISH2; PRIC320;
Gene ID	80205
mRNA Refseq	NM_025134
Protein Refseq	NP_079410
MIM	616936
UniProt ID	Q3L8U1