Recombinant Full Length Human CHD9 Protein, GST-tagged

Cat.No. : CHD9-3186HF
Product Overview : Human CHD9 full-length ORF (AAH33770, 1 a.a. - 119 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 119 amino acids
Description : CHD9 (Chromodomain Helicase DNA Binding Protein 9) is a Protein Coding gene. Among its related pathways are Mitochondrial Gene Expression and Regulation of lipid metabolism by Peroxisome proliferator-activated receptor alpha (PPARalpha). GO annotations related to this gene include nucleic acid binding and helicase activity. An important paralog of this gene is CHD7.
Molecular Mass : 38.83 kDa
AA Sequence : MLINLLVAQLNMCYLHTLSLIVLQSIPKTNPMVCFQMYQMAVQCGAIRQLLPFQIKMDLLFTNKDIHTLCIKIKALWHTMTLPYFRPMNNKHSVLHYAHNKTEIISTQGRILLASLKIL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CHD9 chromodomain helicase DNA binding protein 9 [ Homo sapiens ]
Official Symbol CHD9
Synonyms CHD9; chromodomain helicase DNA binding protein 9; chromodomain-helicase-DNA-binding protein 9; BC022889; FLJ12178; KIAA0308; CHD-9; proteinx0008; kismet homolog 2; ATP-dependent helicase CHD9; ciprofibrate bound protein p240; chromatin remodeling factor CHROM1; chromatin-remodeling factor CHROM1; chromatin-related mesenchymal modulator; PPAR{gamma}-interacting cofactor 320 kDa; PPAR-alpha-interacting complex protein 320 kDa; peroxisomal proliferator-activated receptor A-interacting complex 320 kDa protein; AD013; CReMM; KISH2; PRIC320;
Gene ID 80205
mRNA Refseq NM_025134
Protein Refseq NP_079410
MIM 616936
UniProt ID Q3L8U1

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CHD9 Products

Required fields are marked with *

My Review for All CHD9 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon