Recombinant Full Length Human CHCHD6 Protein, C-Flag-tagged

• Cat.No.: CHCHD6-2102HFL
• Product Overview: Recombinant Full Length Human CHCHD6 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: Involved in cellular response to DNA damage stimulus and cristae formation. Located in cytosol and mitochondrial inner membrane. Part of MICOS complex.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 26.3 kDa
• AA Sequence: MGSTESSEGRRVSFGVDEEERVRVLQGVRLSENVVNRMKEPSSPPPAPTSSTFGLQDGNLRAPHKESTLP RSGSSGGQQPSGMKEGVKRYEQEHAAIQDKLFQVAKREREAATKHSKASLPTGEGSISHEEQKSVRLARE LESREAELRRRDTFYKEQLERIERKNAEMYKLSSEQFHEAASKMESTIKPRRVEPVCSGLQAQILHCYRD RPHEVLLCSDLVKAYQRCVSAAHKG myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Full Length: Full L.

Gene Information

• Gene Name: CHCHD6 coiled-coil-helix-coiled-coil-helix domain containing 6 [ Homo sapiens (human) ]
• Official Symbol: CHCHD6
• Synonyms: CHCM1; Mic25; MICOS25; PPP1R23
• Gene ID: 84303
• mRNA Refseq: NM_032343.3
• Protein Refseq: NP_115719.1
• MIM: 615634
• UniProt ID: Q9BRQ6