Recombinant Full Length Human CHCHD3 Protein, C-Flag-tagged
Cat.No. : | CHCHD3-1591HFL |
Product Overview : | Recombinant Full Length Human CHCHD3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is an inner mitochondrial membrane scaffold protein. Absence of the encoded protein affects the structural integrity of mitochondrial cristae and leads to reductions in ATP production, cell growth, and oxygen consumption. This protein is part of the mitochondrial contact site and cristae organizing system (MICOS). Several transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 26 kDa |
AA Sequence : | MGGTTSTRRVTFEADENENITVVKGIRLSENVIDRMKESSPSGSKSQRYSGAYGASVSDEELKRRVAEEL ALEQAKKESEDQKRLKQAKELDRERAAANEQLTRAILRERICSEEERAKAKHLARQLEEKDRVLKKQDAF YKEQLARLEERSSEFYRVTTEQYQKAAEEVEAKFKRYESHPVCADLQAKILQCYRENTHQTLKCSALATQ YMHCVNHAKQSMLEKGGTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | CHCHD3 coiled-coil-helix-coiled-coil-helix domain containing 3 [ Homo sapiens (human) ] |
Official Symbol | CHCHD3 |
Synonyms | Mic19; MINOS3; MICOS19; PPP1R22 |
Gene ID | 54927 |
mRNA Refseq | NM_017812.4 |
Protein Refseq | NP_060282.1 |
MIM | 613748 |
UniProt ID | Q9NX63 |
◆ Recombinant Proteins | ||
CHCHD3-1591HFL | Recombinant Full Length Human CHCHD3 Protein, C-Flag-tagged | +Inquiry |
CHCHD3-838R | Recombinant Rhesus monkey CHCHD3 Protein, His-tagged | +Inquiry |
CHCHD3-1626M | Recombinant Mouse CHCHD3 Protein, His (Fc)-Avi-tagged | +Inquiry |
CHCHD3-3370M | Recombinant Mouse CHCHD3 Protein | +Inquiry |
CHCHD3-4842H | Recombinant Human CHCHD3 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHCHD3-7545HCL | Recombinant Human CHCHD3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CHCHD3 Products
Required fields are marked with *
My Review for All CHCHD3 Products
Required fields are marked with *
0
Inquiry Basket