Recombinant Full Length Human CHCHD1 Protein, GST-tagged

• Cat.No.: CHCHD1-3310HF
• Product Overview: Human CHCHD1 full-length ORF (AAH15387.1, 1 a.a. - 118 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 118 amino acids
• Description: CHCHD1 (Coiled-Coil-Helix-Coiled-Coil-Helix Domain Containing 1) is a Protein Coding gene. Among its related pathways are Mitochondrial translation and Organelle biogenesis and maintenance. GO annotations related to this gene include poly(A) RNA binding.
• Molecular Mass: 39.38 kDa
• AA Sequence: MATPSLRGRLARFGNPRKPVLKPNKPLILANRVGERRREKGEATCITEMSVMMACWKQNEFRDDACRKEIQGFLDCAARAQEARKMRSIQETLGESGSLLPNKLNKLLQRFPNKPYLS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CHCHD1 coiled-coil-helix-coiled-coil-helix domain containing 1 [ Homo sapiens ]
• Official Symbol: CHCHD1
• Synonyms: CHCHD1; coiled-coil-helix-coiled-coil-helix domain containing 1; C10orf34, chromosome 10 open reading frame 34; coiled-coil-helix-coiled-coil-helix domain-containing protein 1; FLJ25854; nuclear protein C2360; C2360; C10orf34
• Gene ID: 118487
• mRNA Refseq: NM_203298
• Protein Refseq: NP_976043
• MIM: 608842
• UniProt ID: Q96BP2