Description :	This gene encodes a member of the gamma-glutamylcyclotransferase family of proteins. The encoded protein has been shown to promote neuronal differentiation by deglycination of the Notch receptor, which prevents receptor maturation and inhibits Notch signaling. This protein may also play a role in the unfolded protein response, and in regulation of glutathione levels and oxidative balance in the cell. Elevated expression of this gene may indicate increased risk of cancer recurrence among breast and ovarian cancer patients.
Source :	Mammalian cells
Species :	Human
Tag :	Flag
Form :	25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass :	24.2 kDa
AA Sequence :	MKQESAAPNTPPTSQSPTPSAQFPRNDGDPQALWIFGYGSLVWRPDFAYSDSRVGFVRGYSRRFWQGDTF HRGSDKMPGRVVTLLEDHEGCTWGVAYQVQGEQVSKALKYLNVREAVLGGYDTKEVTFYPQDAPDQPLKA LAYVATPQNPGYLGPAPEEAIATQILACRGFSGHNLEYLLRLADFMQLCGPQAQDEHLAAIVDAVGTMLP CFCPTEQALALVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity :	> 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability :	Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage :	Store at -80 centigrade.
Concentration :	>50 ug/mL as determined by microplate BCA method.
Preparation :	Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Full Length :	Full L.

Gene Name	CHAC1 ChaC glutathione specific gamma-glutamylcyclotransferase 1 [ Homo sapiens (human) ]
Official Symbol	CHAC1
Synonyms	MGC4504
Gene ID	79094
mRNA Refseq	NM_024111.6
Protein Refseq	NP_077016.3
MIM	614587
UniProt ID	Q9BUX1

COA

Required fields are marked with *

Required fields are marked with *

Overall Rating *

Cat NO.

Review

Your Name

Phone Number

E-mail Address

Cat.No. :	CHAC1-431HFL
Product Overview :	Recombinant Full Length Human CHAC1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Recombinant Full Length Human CHAC1 Protein, C-Flag-tagged