Recombinant Full Length Human CFL1 Protein, C-Flag-tagged

• Cat.No.: CFL1-1692HFL
• Product Overview: Recombinant Full Length Human CFL1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: The protein encoded by this gene can polymerize and depolymerize F-actin and G-actin in a pH-dependent manner. Increased phosphorylation of this protein by LIM kinase aids in Rho-induced reorganization of the actin cytoskeleton. Cofilin is a widely distributed intracellular actin-modulating protein that binds and depolymerizes filamentous F-actin and inhibits the polymerization of monomeric G-actin in a pH-dependent manner. It is involved in the translocation of actin-cofilin complex from cytoplasm to nucleus.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 18.3 kDa
• AA Sequence: MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYAT FVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCY
  EEVKDRCTLAEKLGGSAVISLEGKPLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Druggable Genome
• Protein Pathways: Axon guidance, Fc gamma R-mediated phagocytosis, Regulation of actin cytoskeleton
• Full Length: Full L.

Gene Information

• Gene Name: CFL1 cofilin 1 [ Homo sapiens (human) ]
• Official Symbol: CFL1
• Synonyms: CFL; cofilin; HEL-S-15
• Gene ID: 1072
• mRNA Refseq: NM_005507.3
• Protein Refseq: NP_005498.1
• MIM: 601442
• UniProt ID: P23528