Recombinant Full Length Human CFB Protein, C-Flag-tagged
Cat.No. : | CFB-834HFL |
Product Overview : | Recombinant Full Length Human CFB Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes complement factor B, a component of the alternative pathway of complement activation. Factor B circulates in the blood as a single chain polypeptide. Upon activation of the alternative pathway, it is cleaved by complement factor D yielding the noncatalytic chain Ba and the catalytic subunit Bb. The active subunit Bb is a serine protease which associates with C3b to form the alternative pathway C3 convertase. Bb is involved in the proliferation of preactivated B lymphocytes, while Ba inhibits their proliferation. This gene localizes to the major histocompatibility complex (MHC) class III region on chromosome 6. This cluster includes several genes involved in regulation of the immune reaction. Polymorphisms in this gene are associated with a reduced risk of age-related macular degeneration. The polyadenylation site of this gene is 421 bp from the 5' end of the gene for complement component 2. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 83 kDa |
AA Sequence : | MGSNLSPQLCLMPFILGLLSGGVTTTPWSLAWPQGSCSLEGVEIKGGSFRLLQEGQALEYVCPSGFYPYP VQTRTCRSTGSWSTLKTQDQKTVRKAECRAIHCPRPHDFENGEYWPRSPYYNVSDEISFHCYDGYTLRGS ANRTCQVNGRWSGQTAICDNGAGYCSNPGIPIGTRKVGSQYRLEDSVTYHCSRGLTLRGSQRRTCQEGGS WSGTEPSCQDSFMYDTPQEVAEAFLSSLTETIEGVDAEDGHGPGEQQKRKIVLDPSGSMNIYLVLDGSDS IGASNFTGAKKCLVNLIEKVASYGVKPRYGLVTYATYPKIWVKVSEADSSNADWVTKQLNEINYEDHKLK SGTNTKKALQAVYSMMSWPDDVPPEGWNRTRHVIILMTDGLHNMGGDPITVIDEIRDLLYIGKDRKNPRE DYLDVYVFGVGPLVNQVNINALASKKDNEQHVFKVKDMENLEDVFYQMIDESQSLSLCGMVWEHRKGTDY HKQPWQAKISVIRPSKGHESCMGAVVSEYFVLTAAHCFTVDDKEHSIKVSVGGEKRDLEIEVVLFHPNYN INGKKEAGIPEFYDYDVALIKLKNKLKYGQTIRPICLPCTEGTTRALRLPPTTTCQQQKEELLPAQDIKA LFVSEEEKKLTRKEVYIKNGDKKGSCERDAQYAPGYDKVKDISEVVTPRFLCTGGVSPYADPNTCRGDSG GPLIVHKRSRFIQVGVISWGVVDVCKNQKRQKQVPAHARDFHINLFQVLPWLKEKLQDEDLGFLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Protease, Secreted Protein |
Protein Pathways : | Complement and coagulation cascades |
Full Length : | Full L. |
Gene Name | CFB complement factor B [ Homo sapiens (human) ] |
Official Symbol | CFB |
Synonyms | BF; FB; BFD; GBG; CFAB; CFBD; PBF2; AHUS4; FBI12; H2-Bf; ARMD14 |
Gene ID | 629 |
mRNA Refseq | NM_001710.6 |
Protein Refseq | NP_001701.2 |
MIM | 138470 |
UniProt ID | P00751 |
◆ Recombinant Proteins | ||
CFB-8924Z | Recombinant Zebrafish CFB | +Inquiry |
CFB-1164M | Recombinant Mouse CFB Protein, His-tagged | +Inquiry |
Cfb-759M | Recombinant Mouse Cfb Protein, His-tagged | +Inquiry |
CFB-1382H | Recombinant Human CFB Protein (Tyr573-Leu761), N-His tagged | +Inquiry |
CFB-334H | Recombinant Human CFB Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
CFB-104H | Native Human Factor B | +Inquiry |
◆ Cell & Tissue Lysates | ||
CFB-7558HCL | Recombinant Human CFB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CFB Products
Required fields are marked with *
My Review for All CFB Products
Required fields are marked with *
0
Inquiry Basket