Recombinant Full Length Human CFAP69 Protein, GST-tagged

Cat.No. : CFAP69-3867HF
Product Overview : Human C7orf63 full-length ORF ( ENSP00000340357, 1 a.a. - 229 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
ProteinLength : 229 amino acids
Description : CFAP69 (Cilia And Flagella Associated Protein 69) is a Protein Coding gene. GO annotations related to this gene include binding.
Molecular Mass : 52 kDa
AA Sequence : MWTEEAGATAEAQESGIRNKSSSSSQIPVVGVVTEDDEAQDVFKPMDLNRVIKLLEETDKDGLEEKQLKFVKKLVQCYQNGLPLRDLAQIFKILNLCSGKIKNQPRFIESAYDIIKLCGLPFLKKKVSDEITYAEDTANSIALLGDLMKIPSSELRIQICKCIVDFYHAEPPKKHIPGYQQASSSYKIQMAEVGGLAKTMVQSMTLLENQLVEKLWVLKVLQHLSTSGL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CFAP69 cilia and flagella associated protein 69 [ Homo sapiens (human) ]
Official Symbol CFAP69
Synonyms C7orf63; CFAP69; cilia and flagella associated protein 69; FAP69; cilia- and flagella-associated protein 69
Gene ID 79846
mRNA Refseq NM_001039706
Protein Refseq NP_001034795
MIM 617949
UniProt ID A5D8W1

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CFAP69 Products

Required fields are marked with *

My Review for All CFAP69 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon