Recombinant Full Length Human CFAP65 Protein, GST-tagged

• Cat.No.: CFAP65-2818HF
• Product Overview: Human CFAP65 full-length ORF (AAH31585.1, 1 a.a. - 163 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 163 amino acids
• Description: The protein encoded by this gene has putative coiled-coil domains and may be a transmembrane protein. The chicken ortholog of this gene is involved in the Rose-comb mutation, which is a large chromosome inversion, resulting in altered comb morphology and defects in sperm motility. [provided by RefSeq, Aug 2016]
• Molecular Mass: 44.9 kDa
• AA Sequence: MLTQAPSSVVRSRNSRNHTVNSGGSCLSASTVAIPAINDSSAAMSACSTISAQPASSMDTQMHSPKKQERVNKRVIWGIEVAEELHWKGWELGKETTRNLVLKNRSLKLQKMKYRYQYKGSRTQCHSLEPRKQALFKTKQNKQKKPLTCHIKASECLKYMQYE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CFAP65 cilia and flagella associated protein 65 [ Homo sapiens (human) ]
• Official Symbol: CFAP65
• Synonyms: CFAP65; cilia and flagella associated protein 65; CCDC108; coiled-coil domain containing 108; coiled-coil domain-containing protein 108; DKFZp434O0527; MGC35338
• Gene ID: 255101
• mRNA Refseq: NM_152389
• Protein Refseq: NP_689602
• MIM: 614270
• UniProt ID: Q6ZU64