Recombinant Full Length Human CFAP157 Protein, GST-tagged

• Cat.No.: CFAP157-2682HF
• Product Overview: Human C9orf117 full-length ORF (1 a.a. - 273 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 273 amino acids
• Description: CFAP157 (Cilia And Flagella Associated Protein 157) is a Protein Coding gene.
• Molecular Mass: 56.2 kDa
• AA Sequence: MGTEVGISWTRVGTGATVGLLPPHPHQQMHRDEEDSDVDVTFQPWHKEMLQQLLVMLSSTVATRPQKAACPHQESQSHGPPKESRPSIQLPRTGSLLPQLSDITPYQPGDLGLVPRQVHIPPNPQDLRLLSSITRVGTFRAHSSPEQGKSGIPLKRPQLPSQHLSFFFFFFFFLRQSLTLSPRLECSATISAHSNLRLPGSSDSPASVSQVAGITGMHHHAWLLFVFLVETGFHHVGQAGLELLTSSNPPASASQSAGIIGVSHCTRPPSQHL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CFAP157 cilia and flagella associated protein 157 [ Homo sapiens (human) ]
• Official Symbol: CFAP157
• Synonyms: CFAP157; cilia and flagella associated protein 157; C9ORF117; chromosome 9 open reading frame 117; uncharacterized protein C9orf117; RP11-56D16.5
• Gene ID: 286207
• mRNA Refseq: NM_001012502
• Protein Refseq: NP_001012520
• UniProt ID: Q5JU67