Recombinant Full Length Human CERK Protein, GST-tagged

• Cat.No.: CERK-3248HF
• Product Overview: Human CERK full-length ORF (AAH04278, 1 a.a. - 201 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 201 amino acids
• Description: CERK converts ceramide to ceramide 1-phosphate (C1P), a sphingolipid metabolite. Both CERK and C1P have been implicated in various cellular processes, including proliferation, apoptosis, phagocytosis, and inflammation (Kim et al., 2006 [PubMed 16488390]).[supplied by OMIM, Mar 2008]
• Molecular Mass: 47.85 kDa
• AA Sequence: MQRGPASGDPREGPPRQRREGCWGLHTCLITAARLRQSGWEHDLGVCSGSTDDKLWKLAVCKALASLLLLKCQIPMLYIDAKCLTQPGLGAVRRKLAIRGGGAGPGLPQDSSEAGPEVCTRGPDLSLSFLHTEFSIFIEHLVLLSQSSVNCVSDVCLLPRSHDGSLVSSAARGLRRPEDSSRKAFLPRSPGHPSIVYYVLV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CERK ceramide kinase [ Homo sapiens ]
• Official Symbol: CERK
• Synonyms: CERK; ceramide kinase; dA59H18.2; dA59H18.3; DKFZp434E0211; FLJ21430; FLJ23239; hCERK; KIAA1646; LK4; lipid kinase 4; lipid kinase LK4; acylsphingosine kinase; MGC131878
• Gene ID: 64781
• mRNA Refseq: NM_022766
• Protein Refseq: NP_073603
• MIM: 610307
• UniProt ID: Q8TCT0