Recombinant Full Length Human CEP112 Protein, GST-tagged

• Cat.No.: CEP112-3154HF
• Product Overview: Human CEP112 full-length ORF (NP_001032402.1, 1 a.a. - 211 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a coiled-coil domain containing protein that belongs to the cell division control protein 42 effector protein family. In neurons, it localizes to the cytoplasm of dendrites and is also enriched in the nucleus where it interacts with the RNA polymerase III transcriptional repressor Maf1 to regulate gamma-aminobutyric acid A receptor surface expression. In addition, the protein has been identified as a component of the human centrosome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2014]
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 50.9 kDa
• Protein length: 211 amino acids
• AA Sequence: MWASLSLDHPSAKENQALRLIEMREENGNVPKTEQAGSLKPLRDTGKSNLKEKKANSKLKQIEKEYTQKLAKSSQIIAELQTTISSLKEENSQQQLAAERRLQDVRQKFEDEKKQLIRDNDQAIKVLQDELENRSNQVRCAEKKLQHKELESQEQITYIRQEYETKLKGLMPASLRQELEDTISSLKSQVNFLQKRASILQEELTTYQGRR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CEP112 centrosomal protein 112kDa [ Homo sapiens ]
• Official Symbol: CEP112
• Synonyms: CEP112; centrosomal protein 112kDa; CCDC46, coiled coil domain containing 46; centrosomal protein of 112 kDa; MGC33887; coiled-coil domain containing 46; coiled-coil domain-containing protein 46; CCDC46; MACOCO; FLJ39610
• Gene ID: 201134
• mRNA Refseq: NM_001037325
• Protein Refseq: NP_001032402
• MIM: 618980
• UniProt ID: Q8N8E3