Recombinant Full Length Human CELF5 Protein, GST-tagged

• Cat.No.: CELF5-3818HF
• Product Overview: Human BRUNOL5 full-length ORF ( AAH47522.1, 1 a.a. - 402 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 69.5 kDa
• Protein length: 402 amino acids
• AA Sequence: MARLTESEARRQQQQLLQPRPSPVGSSGPEPPGGQPDGMKDLDAIKLFVGQIPRHLDEKDLKPLLEQFGRIYELTVLKDPYTGMHKGCAFLTYCARDSAIKAQTALHEQKTLPGMARPIQVKPADSESRGGRDRKLFVGMLNKQQSEEDVLRLFQPFGVIDECTVLRGPDGSSKGCAFVKFSSHTEAQAAIHALHGSQTMPGASSSLVVKFADTDKERTLRRMQQMVGQLGILTPSLTLPFSPYSAYAQALMQQQTTVLSTSGSYLSPGVAFSPCHIQQIGAVSLNGLPATPIAPASGLHSPPLLGTTAVPGLVAPITNGFAGVVPFSRWAPCPGNRLCQWPCALPSSEPDCGRDTASCLLRSPAVHSHVPHRGHHAHRAQRPPAAAPPAAAAARRSLETRS
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CELF5 CUGBP, Elav-like family member 5 [ Homo sapiens ]
• Official Symbol: CELF5
• Synonyms: CELF5; CUGBP, Elav-like family member 5; Bruno (Drosophila) like 5, RNA binding protein , bruno like 5, RNA binding protein (Drosophila) , BRUNOL5; CUGBP Elav-like family member 5; RNA-binding protein BRUNOL-5; CUG-BP and ETR-3 like factor 5; bruno-like 5 RNA binding protein; CELF-5; BRUNOL5; BRUNOL-5
• Gene ID: 60680
• mRNA Refseq: NM_001172673
• Protein Refseq: NP_001166144
• MIM: 612680
• UniProt ID: Q8N6W0