Recombinant Full Length Human CEBPG Protein, GST-tagged
Cat.No. : | CEBPG-3281HF |
Product Overview : | Human CEBPG full-length ORF (AAH13128, 1 a.a. - 150 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Description : | The C/EBP family of transcription factors regulates viral and cellular CCAAT/enhancer element-mediated transcription. C/EBP proteins contain the bZIP region, which is characterized by two motifs in the C-terminal half of the protein: a basic region involved in DNA binding and a leucine zipper motif involved in dimerization. The C/EBP family consist of several related proteins, C/EBP alpha, C/EBP beta, C/EBP gamma, and C/EBP delta, that form homodimers and that form heterodimers with each other. CCAAT/enhancer binding protein gamma may cooperate with Fos to bind PRE-I enhancer elements. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Nov 2011] |
Source : | In Vitro Cell Free System |
Species : | Human |
Tag : | GST |
Molecular Mass : | 42.24 kDa |
Protein length : | 150 amino acids |
AA Sequence : | MSKISQQNSTPGVNGISVIHTQAHASGLQQVPQLVPAGPGGGGKAVAPSKQSKKSSPMDRNSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKELSVLKDLFLEHAHNLADNVQSISTENTTADGDNAGQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CEBPG CCAAT/enhancer binding protein (C/EBP), gamma [ Homo sapiens ] |
Official Symbol | CEBPG |
Synonyms | CEBPG; CCAAT/enhancer binding protein (C/EBP), gamma; CCAAT/enhancer-binding protein gamma; GPE1BP; IG/EBP 1; c/EBP gamma; IG/EBP-1; |
Gene ID | 1054 |
mRNA Refseq | NM_001252296 |
Protein Refseq | NP_001239225 |
MIM | 138972 |
UniProt ID | P53567 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CEBPG Products
Required fields are marked with *
My Review for All CEBPG Products
Required fields are marked with *
0
Inquiry Basket