Recombinant Full Length Human CEACAM6 Protein, GST-tagged
Cat.No. : | CEACAM6-3275HF |
Product Overview : | Human CEACAM6 full-length ORF (AAH05008.1, 1 a.a. - 344 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 344 amino acids |
Description : | This gene encodes a protein that belongs to the carcinoembryonic antigen (CEA) family whose members are glycosyl phosphatidyl inositol (GPI) anchored cell surface glycoproteins. Members of this family play a role in cell adhesion and are widely used as tumor markers in serum immunoassay determinations of carcinoma. This gene affects the sensitivity of tumor cells to adenovirus infection. The protein encoded by this gene acts as a receptor for adherent-invasive E. coli adhesion to the surface of ileal epithelial cells in patients with Crohn's disease. This gene is clustered with genes and pseudogenes of the cell adhesion molecules subgroup of the CEA family on chromosome 19. [provided by RefSeq, Apr 2014] |
Molecular Mass : | 63.47 kDa |
AA Sequence : | MGPPSAPPCRLHVPWKEVLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDVPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSGSAPVLSAVATVGITIGVLARVALI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CEACAM6 carcinoembryonic antigen-related cell adhesion molecule 6 (non-specific cross reacting antigen) [ Homo sapiens ] |
Official Symbol | CEACAM6 |
Synonyms | CEACAM6; carcinoembryonic antigen-related cell adhesion molecule 6 (non-specific cross reacting antigen); NCA; carcinoembryonic antigen-related cell adhesion molecule 6; CD66c; normal cross-reacting antigen; non-specific crossreacting antigen; CEAL; |
Gene ID | 4680 |
mRNA Refseq | NM_002483 |
Protein Refseq | NP_002474 |
MIM | 163980 |
UniProt ID | P40199 |
◆ Recombinant Proteins | ||
CEACAM6-179H | Recombinant Human CEACAM6 Protein, His-tagged | +Inquiry |
CEACAM6-046C | Recombinant Cynomolgus CEACAM6 Protein, His-tagged | +Inquiry |
CEACAM6-3275HF | Recombinant Full Length Human CEACAM6 Protein, GST-tagged | +Inquiry |
CEACAM6-2684H | Recombinant Human CEACAM6 protein, His-SUMO-tagged | +Inquiry |
CEACAM6-27919TH | Recombinant Human CEACAM6 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CEACAM6-2797HCL | Recombinant Human CEACAM6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CEACAM6 Products
Required fields are marked with *
My Review for All CEACAM6 Products
Required fields are marked with *
0
Inquiry Basket