Recombinant Full Length Human CDKN2B Protein, GST-tagged

• Cat.No.: CDKN2B-3229HF
• Product Overview: Human CDKN2B full-length ORF (AAH14469, 1 a.a. - 138 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Entrez Gene Summary for CDKN2B Gene
  This gene lies adjacent to the tumor suppressor gene CDKN2A in a region that is frequently mutated and deleted in a wide variety of tumors. This gene encodes a cyclin-dependent kinase inhibitor, which forms a complex with CDK4 or CDK6, and prevents the activation of the CDK kinases, thus the encoded protein functions as a cell growth regulator that controls cell cycle G1 progression. The expression of this gene was found to be dramatically induced by TGF beta, which suggested its role in the TGF beta induced growth inhibition. Two alternatively spliced transcript variants of this gene, which encode distinct proteins, have been reported. [provided by RefSeq, Jul 2008]
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 40.92 kDa
• Protein length: 138 amino acids
• AA Sequence: MREENKGIPSGGGSDEGLASAAARGLVEKVRQLLEAGADPNGVNRFGRRAIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEERGHRDVAGYLRTATGD
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CDKN2B cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4) [ Homo sapiens ]
• Official Symbol: CDKN2B
• Synonyms: CDKN2B; cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4); cyclin-dependent kinase 4 inhibitor B; CDK4I; INK4B; MTS2; P15; p15INK4b; TP15; MTS-2; p14-INK4b; p14_INK4B; p15-INK4b; p15_INK4B; CDK4B inhibitor; p14_CDK inhibitor; p15 CDK inhibitor; CDK inhibitory protein; multiple tumor suppressor 2; cyclin-dependent kinases 4 and 6 binding protein
• Gene ID: 1030
• mRNA Refseq: NM_004936
• Protein Refseq: NP_004927
• MIM: 600431
• UniProt ID: P42772