Recombinant Human CDKN2B protein, His-tagged

Cat.No. : CDKN2B-134H
Product Overview : Recombinant Human CDKN2B(1-138aa) fused with His tag at N-terminal was expressed in E. coli.
Availability April 20, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-138aa
Description : This gene lies adjacent to the tumor suppressor gene CDKN2A in a region that is frequently mutated and deleted in a wide variety of tumors. This gene encodes a cyclin-dependent kinase inhibitor, which forms a complex with CDK4 or CDK6, and prevents the activation of the CDK kinases, thus the encoded protein functions as a cell growth regulator that controls cell cycle G1 progression. The expression of this gene was found to be dramatically induced by TGF beta, which suggested its role in the TGF beta induced growth inhibition. Two alternatively spliced transcript variants of this gene, which encode distinct proteins, have been reported.
Form : 1M PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH8.0), added with 300 mM Imidazole and 0.7% sarcosyl, 15% glycerol.
AA Sequence : MREENKGMPSGGGSDEGLASAAARGLVEKVRQLLEAGADPNGVNRFGRRAIQVMMMGSARVAELLLLHGAEPNCA DPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEERGHRDVAGYLRTATGD
Storage : Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles.
Shipping : The product is shipped with ice packs. Upon receipt, store it immediately at -20 centigrade to -80 centigrade.
Gene Name CDKN2B cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4) [ Homo sapiens ]
Official Symbol CDKN2B
Synonyms CDKN2B; cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4); cyclin-dependent kinase 4 inhibitor B; CDK4I; INK4B; MTS2; P15; p15INK4b; TP15; MTS-2; p14-INK4b; p14_INK4B; p15-INK4b; p15_INK4B; CDK4B inhibitor; p14_CDK inhibitor; p15 CDK inhibitor; CDK inhibitory protein; multiple tumor suppressor 2; cyclin-dependent kinases 4 and 6 binding protein;
Gene ID 1030
mRNA Refseq NM_004936
Protein Refseq NP_004927
MIM 600431
UniProt ID P42772
Chromosome Location 9p21
Pathway Cell Cycle, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem; Cell cycle, organism-specific biosystem; Cell cycle, conserved biosystem; Cyclin D associated events in G1, organism-specific biosystem; G1 Phase, organism-specific biosystem; G1 to S cell cycle control, organism-specific biosystem;
Function cyclin-dependent protein kinase inhibitor activity; cyclin-dependent protein kinase inhibitor activity; kinase activity; protein binding; protein kinase binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CDKN2B Products

Required fields are marked with *

My Review for All CDKN2B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon