Recombinant Full Length Human CDKN2AIPNL Protein, GST-tagged

• Cat.No.: CDKN2AIPNL-3830HF
• Product Overview: Human CDKN2AIPNL full-length ORF ( ADZ15778.1, 1 a.a. - 116 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 116 amino acids
• Description: CDKN2AIPNL (CDKN2A Interacting Protein N-Terminal Like) is a Protein Coding gene. An important paralog of this gene is CDKN2AIP.
• Molecular Mass: 12.8 kDa
• AA Sequence: MVGGEAAAAVEELVSGVRQAADFAEQFRSYSESEKQWKARMEFILRHLPDYRDPPDGSGRLDQLLSLSMVWANHLFLGCSYNKDLLDKVMEMADGIEVEDLPQFTTRSELMKKHQS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CDKN2AIPNL CDKN2A interacting protein N-terminal like [ Homo sapiens (human) ]
• Official Symbol: CDKN2AIPNL
• Synonyms: CDKN2AIPNL; CDKN2A interacting protein N-terminal like; CDKN2AIP N-terminal-like protein; CDKN2A-interacting protein N-terminal-like protein
• Gene ID: 91368
• mRNA Refseq: NM_080656
• Protein Refseq: NP_542387
• UniProt ID: Q96HQ2