Recombinant Full Length Human CDK5R1 Protein, GST-tagged

Cat.No. : CDK5R1-3125HF
Product Overview : Human CDK5R1 full-length ORF (AAH20580.1, 1 a.a. - 307 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 307 amino acids
Description : The protein encoded by this gene (p35) is a neuron-specific activator of cyclin-dependent kinase 5 (CDK5); the activation of CDK5 is required for proper development of the central nervous system. The p35 form of this protein is proteolytically cleaved by calpain, generating a p25 form. The cleavage of p35 into p25 results in relocalization of the protein from the cell periphery to nuclear and perinuclear regions. P25 deregulates CDK5 activity by prolonging its activation and changing its cellular location. The p25 form accumulates in the brain neurons of patients with Alzheimer's disease. This accumulation correlates with an increase in CDK5 kinase activity, and may lead to aberrantly phosphorylated forms of the microtubule-associated protein tau, which contributes to Alzheimer's disease. [provided by RefSeq, Jul 2008]
Molecular Mass : 60.5 kDa
AA Sequence : MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSAKKKNSKKVQPNSSYQNNITHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTGGSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CDK5R1 cyclin-dependent kinase 5, regulatory subunit 1 (p35) [ Homo sapiens ]
Official Symbol CDK5R1
Synonyms CDK5R1; cyclin-dependent kinase 5, regulatory subunit 1 (p35); cyclin-dependent kinase 5 activator 1; Nck5a; p35nck5a; CDK5 activator 1; neuronal CDK5 activator; TPKII regulatory subunit; regulatory partner for CDK5 kinase; tau protein kinase II 23kDa subunit; cyclin-dependent kinase 5 regulatory subunit 1; p23; p25; p35; CDK5R; NCK5A; CDK5P35; MGC33831;
Gene ID 8851
mRNA Refseq NM_003885
Protein Refseq NP_003876
MIM 603460
UniProt ID Q15078

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CDK5R1 Products

Required fields are marked with *

My Review for All CDK5R1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon