Recombinant Full Length Human CDK5 Protein, GST-tagged

• Cat.No.: CDK5-3185HF
• Product Overview: Human CDK5 full-length ORF (NP_004926.1, 1 a.a. - 292 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a proline-directed serine/threonine kinase that is a member of the cyclin-dependent kinase family of proteins. Unlike other members of the family, the protein encoded by this gene does not directly control cell cycle regulation. Instead the protein, which is predominantly expressed at high levels in mammalian postmitotic central nervous system neurons, functions in diverse processes such as synaptic plasticity and neuronal migration through phosphorylation of proteins required for cytoskeletal organization, endocytosis and exocytosis, and apoptosis. In humans, an allelic variant of the gene that results in undetectable levels of the protein has been associated with lethal autosomal recessive lissencephaly-7. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2015]
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 57.75 kDa
• Protein length: 292 amino acids
• AA Sequence: MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CDK5 cyclin-dependent kinase 5 [ Homo sapiens ]
• Official Symbol: CDK5
• Synonyms: CDK5; cyclin-dependent kinase 5; PSSALRE; TPKII catalytic subunit; protein kinase CDK5 splicing; cell division protein kinase 5; serine/threonine-protein kinase PSSALRE; tau protein kinase II catalytic subunit
• Gene ID: 1020
• mRNA Refseq: NM_001164410
• Protein Refseq: NP_001157882
• MIM: 123831
• UniProt ID: Q00535

Q&As

Is CDK5 derived from human fetal cell lines?

The CDK5 is expressed from HEK293 host, which is a mammalian cells system.