Recombinant Full Length Human CDK2AP1 Protein, GST-tagged

Cat.No. : CDK2AP1-3179HF
Product Overview : Human CDK2AP1 full-length ORF (AAH34717, 1 a.a. - 115 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 115 amino acids
Description : The protein encoded by this gene is a cyclin-dependent kinase 2 (CDK2) -associated protein which is thought to negatively regulate CDK2 activity by sequestering monomeric CDK2, and targeting CDK2 for proteolysis. This protein was found to also interact with DNA polymerase alpha/primase and mediate the phosphorylation of the large p180 subunit, which suggests a regulatory role in DNA replication during the S-phase of the cell cycle. This protein also forms a core subunit of the nucleosome remodeling and histone deacetylation (NURD) complex that epigenetically regulates embryonic stem cell differentiation. This gene thus plays a role in both cell-cycle and epigenetic regulation. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2012]
Molecular Mass : 38.39 kDa
AA Sequence : MSYKPNLAAHMPAAALNAAGSVHSPSTSMATSSQYRQLLSDYGPPSLGYTQGTGNSQVPQSKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CDK2AP1 cyclin-dependent kinase 2 associated protein 1 [ Homo sapiens ]
Official Symbol CDK2AP1
Synonyms CDK2AP1; cyclin-dependent kinase 2 associated protein 1; CDK2 associated protein 1; cyclin-dependent kinase 2-associated protein 1; doc 1; DOC1; DORC1; p12DOC 1; ST19; Deleted in oral cancer-1; deleted in oral cancer 1; CDK2-associated protein 1; putative oral cancer suppressor; doc-1; p12DOC-1;
Gene ID 8099
mRNA Refseq NM_004642
Protein Refseq NP_004633
MIM 602198
UniProt ID O14519

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CDK2AP1 Products

Required fields are marked with *

My Review for All CDK2AP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon