Description :	The protein encoded by this gene is a cyclin-dependent kinase 2 (CDK2) -associated protein which is thought to negatively regulate CDK2 activity by sequestering monomeric CDK2, and targeting CDK2 for proteolysis. This protein was found to also interact with DNA polymerase alpha/primase and mediate the phosphorylation of the large p180 subunit, which suggests a regulatory role in DNA replication during the S-phase of the cell cycle. This protein also forms a core subunit of the nucleosome remodeling and histone deacetylation (NURD) complex that epigenetically regulates embryonic stem cell differentiation. This gene thus plays a role in both cell-cycle and epigenetic regulation. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2012]
Source :	In Vitro Cell Free System
Species :	Human
Tag :	GST
Molecular Mass :	38.39 kDa
Protein length :	115 amino acids
AA Sequence :	MSYKPNLAAHMPAAALNAAGSVHSPSTSMATSSQYRQLLSDYGPPSLGYTQGTGNSQVPQSKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS
Applications :	Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array
Storage :	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Name	CDK2AP1 cyclin-dependent kinase 2 associated protein 1 [ Homo sapiens ]
Official Symbol	CDK2AP1
Synonyms	CDK2AP1; cyclin-dependent kinase 2 associated protein 1; CDK2 associated protein 1; cyclin-dependent kinase 2-associated protein 1; doc 1; DOC1; DORC1; p12DOC 1; ST19; Deleted in oral cancer-1; deleted in oral cancer 1; CDK2-associated protein 1; putative oral cancer suppressor; doc-1; p12DOC-1;
Gene ID	8099
mRNA Refseq	NM_004642
Protein Refseq	NP_004633
MIM	602198
UniProt ID	O14519