Recombinant Full Length Human CDCP2 Protein, GST-tagged

• Cat.No.: CDCP2-3124HF
• Product Overview: Human CDCP2 full-length ORF (1 a.a. - 157 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 329 amino acids
• Description: CDCP2 (CUB Domain Containing Protein 2) is a Protein Coding gene. An important paralog of this gene is CUBN.
• Molecular Mass: 43.2 kDa
• AA Sequence: MLAEWGACLLLAVALLGPGLQAQAMEGVKCGGVLSAPSGNFSSPNFPRLYPYNTECSWLIVVAEGSSVLLTFHAFDLEYHDTCSFDFLEIYNGASPDKGNLLGRFCGKVPPPPFTSSWHVMSVIFHSDKHVASHGFSAGYQKGQRGALGTCCSGSHL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CDCP2 CUB domain containing protein 2 [ Homo sapiens ]
• Official Symbol: CDCP2
• Synonyms: CDCP2; CUB domain containing protein 2; CUB domain-containing protein 2
• Gene ID: 200008
• mRNA Refseq: NM_201546
• Protein Refseq: NP_963840
• MIM: 612320
• UniProt ID: Q5VXM1